StarFunc result for job id P02452

User Input

>input (1464 residues)
MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRI
CVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPR
GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGP
MGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR
PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ
MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGP
RGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP
QGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGL
PGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGL
TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV
PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGE
QGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGS
QGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD
KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP
PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP
AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGV
VGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGA
EGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGP
VGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGP
RGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR
DLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKD
KRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQ
TGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPII
DVAPLDVGAPDQEFGFDVGPVCFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QJC9	0.182	0.184	0.000	1447	0.780	0.789	F1QJC9.pdb.gz
2	AFDB:P02452	1.000	1.000	0.000	1464	1.000	1.000	P02452.pdb.gz	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
3	AFDB:F1QDL1	0.180	0.182	4.532E-101	1449	0.728	0.736	F1QDL1.pdb.gz
4	AFDB:P02458	0.197	0.194	4.882E-95	1487	0.722	0.711	P02458.pdb.gz	CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3
5	AFDB:Q2LDA1	0.224	0.221	1.586E-90	1491	0.694	0.681	Q2LDA1.pdb.gz	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
6	AFDB:P02461	0.177	0.176	7.100E-74	1466	0.619	0.618	P02461.pdb.gz	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
7	AFDB:F1LQ00	0.169	0.166	2.476E-71	1494	0.600	0.588	F1LQ00.pdb.gz	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
8	AFDB:P02467	0.167	0.179	1.833E-69	1363	0.596	0.640	P02467.pdb.gz	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
9	AFDB:Q6IQX2	0.182	0.197	5.117E-68	1352	0.586	0.635	Q6IQX2.pdb.gz	Q6IQX2_DANRE Collagen alpha-2(I) chain precursor OS=Danio rerio OX=7955 GN=alpha2(I) PE=1 SV=1
10	AFDB:P02466	0.174	0.185	5.346E-66	1372	0.589	0.628	P02466.pdb.gz	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
11	PDB:1m1jB	0.045	0.132	1.201E-3	402	0.023	0.082	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
12	PDB:1ei3C	0.048	0.146	8.454E-3	397	0.018	0.068	1ei3C.pdb.gz
13	PDB:5ffoG	0.060	0.192	1.986E-1	297	0.012	0.061	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
14	PDB:5zc0A	0.043	0.181	2.104E-1	281	0.016	0.082	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
15	PDB:2fmdA	0.044	0.158	2.803E-1	232	0.020	0.125	2fmdA.pdb.gz	Structural basis of carbohydrate recognition by a Man(alpha1-2)Man-specific lectin from Bowringia milbraedii.
16	PDB:1r3fA	0.041	0.139	2.968E-1	278	0.010	0.050	1r3fA.pdb.gz
17	PDB:2e31A	0.034	0.126	2.968E-1	246	0.008	0.045	2e31A.pdb.gz
18	PDB:7emzA	0.042	0.157	3.955E-1	278	0.011	0.058	7emzA.pdb.gz	Molecular insights into the endoperoxide formation by Fe(II)/ alpha-KG-dependent oxygenase NvfI.
19	PDB:5h4bA	0.048	0.247	4.189E-1	136	0.012	0.132	5h4bA.pdb.gz
20	PDB:4fixA	0.046	0.097	4.436E-1	629	0.006	0.014	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3H5	1003	1366	0.563	0.603	A0A0S2Z3H5_HUMAN Collagen type I alpha 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=COL1A2 PE=2 SV=1
2	A0A8I6AII1	1036	1497	0.607	0.593	A0A8I6AII1_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=1
3	A0A8I6GEX8	1040	1498	0.602	0.589	A0A8I6GEX8_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=4 SV=1
4	B3DLK0	1107	1421	0.656	0.676	B3DLK0_DANRE Col2a1a protein OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
5	F1LQ00	1048	1499	0.609	0.594	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
6	H0VHD0	686	1287	0.424	0.483	H0VHD0_CAVPO Collagen type I alpha 2 chain OS=Cavia porcellus OX=10141 GN=COL1A2 PE=4 SV=2
7	L0S5L0	1196	1493	0.695	0.682	L0S5L0_DANRE Collagen type II, alpha-1b OS=Danio rerio OX=7955 GN=im:6788778 PE=2 SV=1
8	P02452	2634	1464	0.999	0.999	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
9	P02453	2570	1463	0.974	0.975	CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus OX=9913 GN=COL1A1 PE=1 SV=3
10	P02454	1650	1453	0.920	0.927	CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a1 PE=1 SV=5
11	P02458	1232	1487	0.715	0.704	CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3
12	P02459	1200	1487	0.715	0.704	CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus OX=9913 GN=COL2A1 PE=1 SV=4
13	P02460	819	859	0.428	0.729	CO2A1_CHICK Collagen alpha-1(II) chain (Fragment) OS=Gallus gallus OX=9031 GN=COL2A1 PE=2 SV=2
14	P02461	724	1466	0.555	0.555	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
15	P02466	1180	1372	0.596	0.636	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
16	P02467	1013	1363	0.555	0.596	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
17	P05539	1151	1419	0.675	0.696	CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus OX=10116 GN=Col2a1 PE=1 SV=2
18	P05997	990	1499	0.600	0.586	CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3
19	P08121	677	1464	0.545	0.545	CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus OX=10090 GN=Col3a1 PE=1 SV=4
20	P08123	1003	1366	0.563	0.603	CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens OX=9606 GN=COL1A2 PE=1 SV=7

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	6e-113	387.4	Fibrillar collagen C-terminal domain
2	PF01391 Collagen	1.3e-173	574.2	Collagen triple helix repeat (20 copies)
3	PF00093 VWC	2.3e-08	45.5	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225964

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297268	0.999	Collagen alpha-2(I) chain
2	9606.ENSP00000231061	0.989	SPARC
3	9606.ENSP00000304408	0.989	Collagen alpha-1(III) chain
4	9606.ENSP00000360493	0.985	Runt-related transcription factor 2
5	9606.ENSP00000364000	0.983	Collagen alpha-2(V) chain
6	9606.ENSP00000266718	0.980	Lumican
7	9606.ENSP00000223061	0.975	Procollagen C-endopeptidase enhancer 1
8	9606.ENSP00000379350	0.972	Integrin beta-1
9	9606.ENSP00000251582	0.970	A disintegrin and metalloproteinase with thrombospondin motifs 2
10	9606.ENSP00000305714	0.969	Bone morphogenetic protein 1
11	9606.ENSP00000219070	0.967	72 kDa type IV collagenase
12	9606.ENSP00000296585	0.966	Integrin alpha-2
13	9606.ENSP00000052754	0.959	Decorin
14	9606.ENSP00000355180	0.956	Collagen alpha-1(VI) chain
15	9606.ENSP00000360882	0.955	Collagen alpha-1(V) chain
16	9606.ENSP00000401749	0.951	Prolyl 4-hydroxylase subunit alpha-3
17	9606.ENSP00000452786	0.950	Integrin beta-3
18	9606.ENSP00000346839	0.949	Fibronectin type III domain containing
19	9606.ENSP00000286657	0.948	A disintegrin and metalloproteinase with thrombospondin motifs 3
20	9606.ENSP00000300527	0.948	Collagen alpha-2(VI) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.998	extracellular matrix structural constituent
GO:0019838	0.990	growth factor binding
GO:0042802	0.982	identical protein binding
GO:0030020	0.979	extracellular matrix structural constituent conferring tensile strength
GO:0019899	0.919	enzyme binding
GO:0002020	0.891	protease binding
GO:0048407	0.774	platelet-derived growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0032501	0.993	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.990	cellular process
GO:0065007	0.979	biological regulation
GO:0050789	0.970	regulation of biological process
GO:0007275	0.947	multicellular organism development
GO:0050794	0.914	regulation of cellular process
GO:0048513	0.893	animal organ development
GO:0009653	0.891	anatomical structure morphogenesis
GO:0001503	0.878	ossification
GO:0048731	0.875	system development
GO:0050896	0.874	response to stimulus
GO:0001501	0.840	skeletal system development
GO:0048518	0.783	positive regulation of biological process
GO:0009888	0.676	tissue development
GO:0051239	0.650	regulation of multicellular organismal process
GO:0048522	0.648	positive regulation of cellular process
GO:0050793	0.572	regulation of developmental process
GO:0048583	0.534	regulation of response to stimulus
GO:0051716	0.503	cellular response to stimulus
GO:0051171	0.490	regulation of nitrogen compound metabolic process
GO:0080090	0.483	regulation of primary metabolic process
GO:0071840	0.480	cellular component organization or biogenesis
GO:0031323	0.477	regulation of cellular metabolic process
GO:0060255	0.465	regulation of macromolecule metabolic process
GO:0016043	0.445	cellular component organization
GO:0008152	0.438	metabolic process
GO:0031214	0.425	biomineral tissue development
GO:0007154	0.413	cell communication
GO:0010646	0.395	regulation of cell communication
GO:0023051	0.385	regulation of signaling
GO:0007165	0.385	signal transduction
GO:0048519	0.373	negative regulation of biological process
GO:0048523	0.336	negative regulation of cellular process
GO:0010468	0.332	regulation of gene expression
GO:0051094	0.328	positive regulation of developmental process
GO:0045595	0.328	regulation of cell differentiation
GO:0042221	0.305	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0071944	0.998	cell periphery
GO:0032991	0.991	protein-containing complex
GO:0005576	0.987	extracellular region
GO:0062023	0.939	collagen-containing extracellular matrix
GO:0005615	0.919	extracellular space
GO:0043229	0.918	intracellular organelle
GO:0043231	0.907	intracellular membrane-bounded organelle
GO:0012505	0.850	endomembrane system
GO:0070013	0.828	intracellular organelle lumen
GO:0099081	0.762	supramolecular polymer
GO:0005788	0.621	endoplasmic reticulum lumen
GO:0005581	0.581	collagen trimer
GO:0098644	0.515	complex of collagen trimers
GO:0099512	0.496	supramolecular fiber
GO:0005583	0.442	fibrillar collagen trimer
GO:0005584	0.383	collagen type I trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]