StarFunc result for job id P02458

User Input

>input (1487 residues)
MIRLGAPQTLVLLTLLVAAVLRCQGQDVQEAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDVKDCLSPEIPFGECCPICPTDLATASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG
LPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPG
DDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAG
PTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLK
SLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTK
HTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02458	0.999	0.999	0.000	1487	1.000	1.000	P02458.pdb.gz	CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3
2	AFDB:Q2LDA1	0.180	0.179	0.000	1491	0.822	0.820	Q2LDA1.pdb.gz	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
3	AFDB:A0A0H2UKU2	0.174	0.192	1.356E-96	1344	0.744	0.823	A0A0H2UKU2.pdb.gz
4	AFDB:F1QJC9	0.177	0.181	2.476E-95	1447	0.694	0.713	F1QJC9.pdb.gz
5	AFDB:P02452	0.194	0.197	1.307E-93	1464	0.709	0.720	P02452.pdb.gz	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
6	AFDB:F1QDL1	0.182	0.186	1.804E-92	1449	0.679	0.697	F1QDL1.pdb.gz
7	AFDB:F1LQ00	0.169	0.169	3.076E-81	1494	0.645	0.642	F1LQ00.pdb.gz	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
8	AFDB:P02461	0.161	0.163	1.381E-75	1466	0.611	0.620	P02461.pdb.gz	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
9	AFDB:P02467	0.167	0.182	1.306E-66	1363	0.589	0.643	P02467.pdb.gz	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
10	AFDB:P02466	0.165	0.178	1.077E-64	1372	0.577	0.625	P02466.pdb.gz	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
11	PDB:1m1jB	0.047	0.143	1.635E-3	402	0.024	0.087	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
12	PDB:5e7gA	0.060	0.157	1.910E-2	446	0.014	0.047	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
13	PDB:5zc0A	0.043	0.177	4.667E-2	281	0.014	0.075	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
14	PDB:6yxyAE	0.042	0.094	1.079E-1	434	0.024	0.081	6yxyAE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
15	PDB:7emzA	0.059	0.215	1.508E-1	278	0.019	0.101	7emzA.pdb.gz	Molecular insights into the endoperoxide formation by Fe(II)/ alpha-KG-dependent oxygenase NvfI.
16	PDB:4kncB	0.047	0.143	1.784E-1	419	0.009	0.031	4kncB.pdb.gz
17	PDB:7bvfB	0.060	0.081	1.784E-1	1054	0.010	0.014	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
18	PDB:2w7qA	0.038	0.170	2.494E-1	192	0.015	0.115	2w7qA.pdb.gz
19	PDB:3ix0B	0.033	0.362	2.494E-1	94	0.007	0.106	3ix0B.pdb.gz
20	PDB:7bvfA	0.049	0.064	2.637E-1	1087	0.013	0.018	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3H5	1022	1366	0.562	0.611	A0A0S2Z3H5_HUMAN Collagen type I alpha 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=COL1A2 PE=2 SV=1
2	A0A8I6AII1	1198	1497	0.650	0.645	A0A8I6AII1_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=1
3	A0A8I6GEX8	1208	1498	0.653	0.648	A0A8I6GEX8_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=4 SV=1
4	B3DLK0	1512	1421	0.784	0.821	B3DLK0_DANRE Col2a1a protein OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
5	F1LQ00	1201	1499	0.644	0.638	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
6	H0VHD0	679	1287	0.418	0.483	H0VHD0_CAVPO Collagen type I alpha 2 chain OS=Cavia porcellus OX=10141 GN=COL1A2 PE=4 SV=2
7	L0S5L0	1629	1493	0.827	0.824	L0S5L0_DANRE Collagen type II, alpha-1b OS=Danio rerio OX=7955 GN=im:6788778 PE=2 SV=1
8	P02452	1141	1464	0.703	0.714	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
9	P02453	1149	1463	0.704	0.716	CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus OX=9913 GN=COL1A1 PE=1 SV=3
10	P02454	1112	1453	0.691	0.707	CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a1 PE=1 SV=5
11	P02458	2678	1487	1.000	1.000	CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3
12	P02459	2628	1487	0.978	0.978	CO2A1_BOVIN Collagen alpha-1(II) chain OS=Bos taurus OX=9913 GN=COL2A1 PE=1 SV=4
13	P02460	1130	859	0.527	0.912	CO2A1_CHICK Collagen alpha-1(II) chain (Fragment) OS=Gallus gallus OX=9031 GN=COL2A1 PE=2 SV=2
14	P02466	1172	1372	0.578	0.627	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
15	P02467	987	1363	0.546	0.596	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
16	P05539	2376	1419	0.900	0.943	CO2A1_RAT Collagen alpha-1(II) chain OS=Rattus norvegicus OX=10116 GN=Col2a1 PE=1 SV=2
17	P08121	699	1464	0.516	0.524	CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus OX=10090 GN=Col3a1 PE=1 SV=4
18	P08123	1022	1366	0.562	0.611	CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens OX=9606 GN=COL1A2 PE=1 SV=7
19	P11087	1159	1453	0.693	0.710	CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus OX=10090 GN=Col1a1 PE=1 SV=4
20	P13941	739	1463	0.521	0.529	CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus OX=10116 GN=Col3a1 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	7.2e-115	393.7	Fibrillar collagen C-terminal domain
2	PF01391 Collagen	4.2e-170	563.0	Collagen triple helix repeat (20 copies)
3	PF00093 VWC	4.3e-08	44.7	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286657	0.971	A disintegrin and metalloproteinase with thrombospondin motifs 3
2	9606.ENSP00000379350	0.960	Integrin beta-1
3	9606.ENSP00000359114	0.959	Collagen alpha-1(XI) chain
4	9606.ENSP00000251582	0.945	A disintegrin and metalloproteinase with thrombospondin motifs 2
5	9606.ENSP00000223061	0.936	Procollagen C-endopeptidase enhancer 1
6	9606.ENSP00000305714	0.930	Bone morphogenetic protein 1
7	9606.ENSP00000362304	0.929	A disintegrin and metalloproteinase with thrombospondin motifs 14
8	9606.ENSP00000358310	0.924	Integrin alpha-10
9	9606.ENSP00000452786	0.924	Integrin beta-3
10	9606.ENSP00000363840	0.921	Collagen alpha-2(XI) chain
11	9606.ENSP00000384999	0.921	Prolyl 4-hydroxylase subunit alpha-2
12	9606.ENSP00000261023	0.920	Integrin alpha-V
13	9606.ENSP00000263556	0.919	Prolyl 4-hydroxylase subunit alpha-1
14	9606.ENSP00000282588	0.914	Integrin alpha-1
15	9606.ENSP00000296585	0.914	Integrin alpha-2
16	9606.ENSP00000401749	0.911	Prolyl 4-hydroxylase subunit alpha-3
17	9606.ENSP00000061240	0.909	Tolloid-like protein 1
18	9606.ENSP00000245479	0.908	Transcription factor SOX-9
19	9606.ENSP00000351273	0.906	Caspase-8
20	9606.ENSP00000350630	0.905	Tolloid-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.999	extracellular matrix structural constituent
GO:0019838	0.991	growth factor binding
GO:0030020	0.984	extracellular matrix structural constituent conferring tensile strength
GO:0005102	0.956	signaling receptor binding
GO:0097367	0.876	carbohydrate derivative binding
GO:0043394	0.866	proteoglycan binding
GO:0042287	0.812	MHC protein binding
GO:0048407	0.774	platelet-derived growth factor binding
GO:0042289	0.512	MHC class II protein binding
GO:0042802	0.401	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.996	anatomical structure development
GO:0009987	0.990	cellular process
GO:0007275	0.986	multicellular organism development
GO:0048731	0.953	system development
GO:0001501	0.942	skeletal system development
GO:0050789	0.906	regulation of biological process
GO:0009653	0.900	anatomical structure morphogenesis
GO:0048513	0.893	animal organ development
GO:0050794	0.834	regulation of cellular process
GO:0050896	0.821	response to stimulus
GO:0009888	0.625	tissue development
GO:0071840	0.480	cellular component organization or biogenesis
GO:0016043	0.446	cellular component organization
GO:0051716	0.445	cellular response to stimulus
GO:0007154	0.374	cell communication
GO:0048869	0.365	cellular developmental process
GO:0030154	0.363	cell differentiation
GO:0007165	0.361	signal transduction
GO:0030198	0.352	extracellular matrix organization
GO:0051239	0.330	regulation of multicellular organismal process
GO:0048518	0.328	positive regulation of biological process
GO:0008152	0.315	metabolic process
GO:0048522	0.302	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.998	cytoplasm
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0032991	0.988	protein-containing complex
GO:0070013	0.975	intracellular organelle lumen
GO:0012505	0.974	endomembrane system
GO:0043227	0.962	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005615	0.940	extracellular space
GO:0005581	0.924	collagen trimer
GO:0005788	0.913	endoplasmic reticulum lumen
GO:0005583	0.901	fibrillar collagen trimer
GO:0005585	0.382	collagen type II trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]