StarFunc result for job id P02461

User Input

>input (1466 residues)
MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSV
LCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRN
GDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPG
PPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPG
ERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPG
SNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAG
ANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPG
AAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPG
SPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPG
PKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAG
TPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKG
EGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPG
VAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPG
KDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAG
PPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDG
LPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAG
SRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRG
PVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGV
GAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPAR
NCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSS
AEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYMD
QASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLP
IVDIAPYDIGGPDQEFGVDVGPVCFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02461	1.000	1.000	0.000	1466	1.000	1.000	P02461.pdb.gz	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
2	AFDB:P12105	0.187	0.215	1.991E-86	1262	0.640	0.743	P12105.pdb.gz	CO3A1_CHICK Collagen alpha-1(III) chain (Fragments) OS=Gallus gallus OX=9031 GN=COL3A1 PE=2 SV=2
3	AFDB:F1QDL1	0.195	0.197	8.495E-75	1449	0.587	0.594	F1QDL1.pdb.gz
4	AFDB:P02458	0.163	0.161	8.987E-75	1487	0.618	0.609	P02458.pdb.gz	CO2A1_HUMAN Collagen alpha-1(II) chain OS=Homo sapiens OX=9606 GN=COL2A1 PE=1 SV=3
5	AFDB:F1QJC9	0.195	0.198	1.125E-74	1447	0.604	0.612	F1QJC9.pdb.gz
6	AFDB:P02452	0.178	0.178	2.484E-73	1464	0.619	0.620	P02452.pdb.gz	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
7	AFDB:Q2LDA1	0.165	0.162	1.014E-72	1491	0.593	0.583	Q2LDA1.pdb.gz	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
8	AFDB:A0A0H2UKU2	0.187	0.203	1.035E-67	1344	0.559	0.610	A0A0H2UKU2.pdb.gz
9	AFDB:F1LQ00	0.165	0.162	2.065E-63	1494	0.550	0.539	F1LQ00.pdb.gz	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
10	AFDB:Q6IQX2	0.182	0.196	2.397E-54	1352	0.516	0.559	Q6IQX2.pdb.gz	Q6IQX2_DANRE Collagen alpha-2(I) chain precursor OS=Danio rerio OX=7955 GN=alpha2(I) PE=1 SV=1
11	PDB:5e7gA	0.053	0.136	1.699E-2	446	0.012	0.040	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
12	PDB:7bvfB	0.056	0.074	5.235E-2	1054	0.014	0.020	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
13	PDB:7emzA	0.061	0.213	5.859E-2	278	0.015	0.079	7emzA.pdb.gz	Molecular insights into the endoperoxide formation by Fe(II)/ alpha-KG-dependent oxygenase NvfI.
14	PDB:7bvfA	0.046	0.060	7.337E-2	1087	0.012	0.016	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
15	PDB:3o12A	0.042	0.174	9.189E-2	185	0.020	0.157	3o12A.pdb.gz
16	PDB:3rjrC	0.055	0.154	2.020E-1	343	0.012	0.052	3rjrC.pdb.gz
17	PDB:4zkqA	0.031	0.089	2.676E-1	388	0.007	0.026	4zkqA.pdb.gz
18	PDB:4kncB	0.044	0.133	2.995E-1	419	0.010	0.033	4kncB.pdb.gz
19	PDB:6yxyAE	0.030	0.068	3.545E-1	434	0.020	0.069	6yxyAE.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
20	PDB:7etlA	0.052	0.173	3.545E-1	294	0.016	0.078	7etlA.pdb.gz	Structural Insight into the Catalytic Mechanism of the Endoperoxide Synthase FtmOx1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3H5	772	1366	0.490	0.526	A0A0S2Z3H5_HUMAN Collagen type I alpha 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=COL1A2 PE=2 SV=1
2	B3DLK0	844	1421	0.531	0.548	B3DLK0_DANRE Col2a1a protein OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
3	F1LQ00	850	1499	0.540	0.528	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
4	H0VHD0	578	1287	0.385	0.439	H0VHD0_CAVPO Collagen type I alpha 2 chain OS=Cavia porcellus OX=10141 GN=COL1A2 PE=4 SV=2
5	L0S5L0	872	1493	0.526	0.516	L0S5L0_DANRE Collagen type II, alpha-1b OS=Danio rerio OX=7955 GN=im:6788778 PE=2 SV=1
6	P02452	795	1464	0.542	0.542	CO1A1_HUMAN Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=6
7	P02453	797	1463	0.542	0.543	CO1A1_BOVIN Collagen alpha-1(I) chain OS=Bos taurus OX=9913 GN=COL1A1 PE=1 SV=3
8	P02454	804	1453	0.537	0.542	CO1A1_RAT Collagen alpha-1(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a1 PE=1 SV=5
9	P02460	662	859	0.376	0.641	CO2A1_CHICK Collagen alpha-1(II) chain (Fragment) OS=Gallus gallus OX=9031 GN=COL2A1 PE=2 SV=2
10	P02461	2631	1466	1.000	1.000	CO3A1_HUMAN Collagen alpha-1(III) chain OS=Homo sapiens OX=9606 GN=COL3A1 PE=1 SV=4
11	P02466	924	1372	0.505	0.540	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
12	P02467	762	1363	0.467	0.503	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
13	P08121	1481	1464	0.903	0.904	CO3A1_MOUSE Collagen alpha-1(III) chain OS=Mus musculus OX=10090 GN=Col3a1 PE=1 SV=4
14	P08123	772	1366	0.490	0.526	CO1A2_HUMAN Collagen alpha-2(I) chain OS=Homo sapiens OX=9606 GN=COL1A2 PE=1 SV=7
15	P11087	823	1453	0.536	0.541	CO1A1_MOUSE Collagen alpha-1(I) chain OS=Mus musculus OX=10090 GN=Col1a1 PE=1 SV=4
16	P13941	1499	1463	0.901	0.903	CO3A1_RAT Collagen alpha-1(III) chain OS=Rattus norvegicus OX=10116 GN=Col3a1 PE=2 SV=3
17	P28481	976	1487	0.614	0.605	CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus OX=10090 GN=Col2a1 PE=1 SV=2
18	Q01149	887	1372	0.509	0.544	CO1A2_MOUSE Collagen alpha-2(I) chain OS=Mus musculus OX=10090 GN=Col1a2 PE=1 SV=2
19	Q2LDA1	846	1491	0.531	0.522	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1
20	Q6IQX2	813	1352	0.493	0.535	Q6IQX2_DANRE Collagen alpha-2(I) chain precursor OS=Danio rerio OX=7955 GN=alpha2(I) PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	2.5e-108	372.3	Fibrillar collagen C-terminal domain
2	PF01391 Collagen	1.3e-159	529.4	Collagen triple helix repeat (20 copies)
3	PF00093 VWC	4.2e-08	44.7	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223061	0.995	Procollagen C-endopeptidase enhancer 1
2	9606.ENSP00000297268	0.991	Collagen alpha-2(I) chain
3	9606.ENSP00000225964	0.989	Collagen alpha-1(I) chain
4	9606.ENSP00000364000	0.983	Collagen alpha-2(V) chain
5	9606.ENSP00000266718	0.982	Lumican
6	9606.ENSP00000305714	0.971	Bone morphogenetic protein 1
7	9606.ENSP00000251582	0.967	A disintegrin and metalloproteinase with thrombospondin motifs 2
8	9606.ENSP00000325527	0.963	Fibrillin-1
9	9606.ENSP00000296585	0.950	Integrin alpha-2
10	9606.ENSP00000379350	0.950	Integrin beta-1
11	9606.ENSP00000355180	0.943	Collagen alpha-1(VI) chain
12	9606.ENSP00000452786	0.943	Integrin beta-3
13	9606.ENSP00000231061	0.942	SPARC
14	9606.ENSP00000261023	0.937	Integrin alpha-V
15	9606.ENSP00000286657	0.937	A disintegrin and metalloproteinase with thrombospondin motifs 3
16	9606.ENSP00000384999	0.933	Prolyl 4-hydroxylase subunit alpha-2
17	9606.ENSP00000401749	0.933	Prolyl 4-hydroxylase subunit alpha-3
18	9606.ENSP00000052754	0.931	Decorin
19	9606.ENSP00000263556	0.931	Prolyl 4-hydroxylase subunit alpha-1
20	9606.ENSP00000295992	0.924	Procollagen C-endopeptidase enhancer 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	0.998	extracellular matrix structural constituent conferring tensile strength
GO:0019838	0.994	growth factor binding
GO:0044877	0.966	protein-containing complex binding
GO:0005102	0.966	signaling receptor binding
GO:0019899	0.926	enzyme binding
GO:0005178	0.924	integrin binding
GO:0002020	0.914	protease binding
GO:0048407	0.778	platelet-derived growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0032502	0.995	developmental process
GO:0048856	0.989	anatomical structure development
GO:0009987	0.976	cellular process
GO:0050896	0.968	response to stimulus
GO:0007275	0.936	multicellular organism development
GO:0050789	0.877	regulation of biological process
GO:0048731	0.876	system development
GO:0048513	0.769	animal organ development
GO:0050794	0.749	regulation of cellular process
GO:0051716	0.583	cellular response to stimulus
GO:0071840	0.545	cellular component organization or biogenesis
GO:0016043	0.528	cellular component organization
GO:0009653	0.498	anatomical structure morphogenesis
GO:0001501	0.403	skeletal system development
GO:0008152	0.379	metabolic process
GO:0048519	0.333	negative regulation of biological process
GO:0043062	0.302	extracellular structure organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.989	cytoplasm
GO:0032991	0.985	protein-containing complex
GO:0005615	0.941	extracellular space
GO:0043226	0.918	organelle
GO:0043229	0.911	intracellular organelle
GO:0043227	0.910	membrane-bounded organelle
GO:0043231	0.892	intracellular membrane-bounded organelle
GO:0012505	0.836	endomembrane system
GO:0070013	0.809	intracellular organelle lumen
GO:0099080	0.755	supramolecular complex
GO:0099081	0.750	supramolecular polymer
GO:0005581	0.721	collagen trimer
GO:0099512	0.652	supramolecular fiber
GO:0005788	0.601	endoplasmic reticulum lumen
GO:0098644	0.592	complex of collagen trimers
GO:0005583	0.571	fibrillar collagen trimer
GO:0005586	0.383	collagen type III trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]