StarFunc result for job id P02462

User Input

>input (1669 residues)
MGPRLSVWLLLLPAALLLHEEHSRAAAKGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGERGFPGI
PGTPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPP
GVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGKPGKDGDKGEKGS
PGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVIGTGPLGEKGERGYPGTPGPRGEPGP
KGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLPGPSGRDGLPGPPGSPG
PPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKGESCLICDIDGYRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQPGAKGEPGEFYFDLRLK
GDKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDT
GPPGPPGYGPAGPIGDKGQAGFPGGPGSPGLPGPKGEPGKIVPLPGPPGAEGLPGSPGFP
GPQGDRGFPGTPGRPGLPGEKGAVGQPGIGFPGPPGPKGVDGLPGDMGPPGTPGRPGFNG
LPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPGVPGEHGAIGPPGLQGI
RGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGIKGEKGFPGFPGLDMPG
PKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVMGTPGQPGSPGPVGAPG
LPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIG
PIGEKGSRGDPGTPGVPGKDGQAGQPGQPGPKGDPGISGTPGAPGLPGPKGSVGGMGLPG
TPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGLRGEKGDQGIAGFPGSPGE
KGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSP
GIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQGQPGLPGLPGPMGPPGLPG
IDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGPPGVPGFQGPKG
LPGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLPGPEGPPGLKGLQGLPGPK
GQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAV
HSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1MA59	0.252	0.252	0.000	1669	0.908	0.908	F1MA59.pdb.gz	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
2	AFDB:Q63ZW6	0.195	0.193	2.956E-87	1691	0.620	0.611	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
3	AFDB:B0UXF7	0.196	0.195	1.315E-85	1679	0.601	0.597	B0UXF7.pdb.gz
4	AFDB:F1LRJ1	0.178	0.178	3.886E-71	1671	0.537	0.537	F1LRJ1.pdb.gz	F1LRJ1_RAT Collagen type IV alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col4a3 PE=4 SV=2
5	AFDB:Q9QZS0	0.188	0.188	1.004E-70	1669	0.539	0.539	Q9QZS0.pdb.gz	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2
6	AFDB:Q01955	0.175	0.175	6.695E-70	1670	0.530	0.529	Q01955.pdb.gz	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
7	AFDB:P17140	0.162	0.155	2.695E-61	1758	0.513	0.487	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
8	AFDB:P08572	0.143	0.140	4.093E-59	1712	0.498	0.485	P08572.pdb.gz	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
9	AFDB:P17139	0.139	0.132	1.102E-57	1759	0.494	0.468	P17139.pdb.gz	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
10	AFDB:Q14031	0.149	0.147	1.540E-57	1691	0.496	0.489	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
11	PDB:4v96AS	0.024	0.092	1.434E-1	242	0.016	0.107	4v96AS.pdb.gz
12	PDB:5k1bA	0.028	0.096	2.505E-1	264	0.010	0.061	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:6xtx4	0.022	0.043	7.649E-1	598	0.013	0.037	6xtx4.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
14	PDB:7ajuCL	0.023	0.039	7.649E-1	808	0.010	0.020	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:3jc54	0.023	0.045	1.131	569	0.008	0.025	3jc54.pdb.gz
16	PDB:6hv92	0.020	0.047	1.413	549	0.005	0.016	6hv92.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
17	PDB:6sh3A	0.020	0.059	1.767	376	0.007	0.029	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
18	PDB:2awnC	0.033	0.108	1.975	344	0.011	0.055	2awnC.pdb.gz	ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.
19	PDB:5u8s4	0.028	0.049	1.975	682	0.010	0.023	5u8s4.pdb.gz	Structure of eukaryotic CMG helicase at a replication fork and implications to replisome architecture and origin initiation.
20	PDB:6u23A	0.030	0.064	2.209	583	0.016	0.046	6u23A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AFK7	0.0	1826	1562	0.836	0.894	A0A8I6AFK7_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
2	A0A8I6AHV3	0.0	702	1678	0.430	0.427	A0A8I6AHV3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
3	A0A8I6AVZ9	0.0	640	1619	0.412	0.425	A0A8I6AVZ9_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
4	B1AVK5	0.0	685	1691	0.394	0.389	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
5	F1KQQ4	0.0	702	1759	0.437	0.414	F1KQQ4_ASCSU Collagen alpha-1(IV) chain (Fragment) OS=Ascaris suum OX=6253 PE=2 SV=1
6	F1M6Q3	0.0	711	1707	0.436	0.426	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
7	F1MA59	0.0	2108	1669	0.909	0.909	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
8	F1RLL9	0.0	642	1712	0.437	0.426	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
9	O18407	0.0	715	1761	0.440	0.417	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
10	P02462	0.0	2961	1669	1.000	1.000	CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens OX=9606 GN=COL4A1 PE=1 SV=4
11	P02463	0.0	2103	1669	0.908	0.908	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4
12	P08120	0.0	864	1779	0.466	0.437	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
13	P08122	0.0	814	1707	0.494	0.483	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
14	P17139	0.0	850	1759	0.480	0.455	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
15	P17140	0.0	688	1758	0.384	0.365	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
16	Q14031	0.0	760	1691	0.485	0.479	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
17	Q9ESQ1	0.0	682	1691	0.393	0.388	Q9ESQ1_MOUSE Type IV collagen alpha 6 chain OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
18	Q9VMV5	0.0	727	1940	0.440	0.379	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
19	P08572	3.40e-175	575	1712	0.280	0.273	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
20	Q9QZS0	9.10e-173	568	1669	0.378	0.378	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01413 C4	1.8e-81	281.2	C-terminal tandem repeated domain in type 4 procollagen
2	PF01391 Collagen	1.7e-194	641.1	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353654	0.999	Collagen alpha-2(IV) chain
2	9606.ENSP00000282588	0.955	Integrin alpha-1
3	9606.ENSP00000379350	0.954	Integrin beta-1
4	9606.ENSP00000296585	0.947	Integrin alpha-2
5	9606.ENSP00000261023	0.946	Integrin alpha-V
6	9606.ENSP00000452786	0.946	Integrin beta-3
7	9606.ENSP00000384999	0.937	Prolyl 4-hydroxylase subunit alpha-2
8	9606.ENSP00000263556	0.928	Prolyl 4-hydroxylase subunit alpha-1
9	9606.ENSP00000378340	0.918	Collagen alpha-6(IV) chain
10	9606.ENSP00000331902	0.917	Collagen alpha-5(IV) chain
11	9606.ENSP00000379866	0.917	Collagen alpha-4(IV) chain
12	9606.ENSP00000401749	0.917	Prolyl 4-hydroxylase subunit alpha-3
13	9606.ENSP00000370542	0.915	Syndecan-1
14	9606.ENSP00000363973	0.913	Alkaline phosphatase, tissue-nonspecific isozyme
15	9606.ENSP00000379823	0.911	Collagen alpha-3(IV) chain
16	9606.ENSP00000354238	0.908	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
17	9606.ENSP00000226284	0.906	Bone sialoprotein 2
18	9606.ENSP00000355361	0.906	Leukocyte surface antigen CD47
19	9606.ENSP00000253496	0.903	Coagulation factor XII
20	9606.ENSP00000351273	0.901	Caspase-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030020	1.000	extracellular matrix structural constituent conferring tensile strength
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0048856	0.995	anatomical structure development
GO:0032501	0.993	multicellular organismal process
GO:0048731	0.963	system development
GO:0050789	0.915	regulation of biological process
GO:0050794	0.893	regulation of cellular process
GO:0050896	0.831	response to stimulus
GO:0071840	0.820	cellular component organization or biogenesis
GO:0016043	0.810	cellular component organization
GO:0048869	0.715	cellular developmental process
GO:0030154	0.714	cell differentiation
GO:0009888	0.686	tissue development
GO:0007154	0.647	cell communication
GO:0023052	0.557	signaling
GO:0051716	0.544	cellular response to stimulus
GO:0007165	0.533	signal transduction
GO:0009653	0.448	anatomical structure morphogenesis
GO:0060429	0.347	epithelium development
GO:0048513	0.339	animal organ development
GO:0007166	0.336	cell surface receptor signaling pathway
GO:0048518	0.333	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0032991	0.999	protein-containing complex
GO:0005576	0.999	extracellular region
GO:0043227	0.995	membrane-bounded organelle
GO:0043229	0.993	intracellular organelle
GO:0012505	0.984	endomembrane system
GO:0070013	0.982	intracellular organelle lumen
GO:0005737	0.980	cytoplasm
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0099080	0.965	supramolecular complex
GO:0099081	0.963	supramolecular polymer
GO:0098644	0.961	complex of collagen trimers
GO:0005581	0.958	collagen trimer
GO:0005604	0.955	basement membrane
GO:0098645	0.946	collagen network
GO:0005587	0.941	collagen type IV trimer
GO:0005615	0.909	extracellular space
GO:0005788	0.881	endoplasmic reticulum lumen
GO:0016020	0.700	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]