StarFunc result for job id P02511

User Input

>input (175 residues)
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02510	0.809	0.809	1.216E-27	175	0.977	0.977	P02510.pdb.gz	CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus OX=9913 GN=CRYAB PE=1 SV=2
2	AFDB:Q9PUR2	0.650	0.674	1.497E-19	168	0.594	0.619	Q9PUR2.pdb.gz	Q9PUR2_DANRE Alpha b crystallin OS=Danio rerio OX=7955 GN=cryab PE=1 SV=1
3	AFDB:P02470	0.719	0.726	2.305E-18	173	0.543	0.549	P02470.pdb.gz	CRYAA_BOVIN Alpha-crystallin A chain OS=Bos taurus OX=9913 GN=CRYAA PE=1 SV=1
4	AFDB:Q8UUZ6	0.774	0.782	8.072E-18	173	0.520	0.526	Q8UUZ6.pdb.gz	Q8UUZ6_DANRE Alpha A crystallin OS=Danio rerio OX=7955 GN=wu:fc06h04 PE=1 SV=1
5	PDB:2ygdA	0.392	0.392	1.538E-17	175	1.000	1.000	2ygdA.pdb.gz
6	AFDB:A0A0R4IG31	0.546	0.531	5.928E-17	180	0.554	0.539	A0A0R4IG31.pdb.gz
7	AFDB:P24622	0.474	0.425	5.984E-15	196	0.543	0.485	P24622.pdb.gz	CRYAA_MOUSE Alpha-crystallin A chain OS=Mus musculus OX=10090 GN=Cryaa PE=2 SV=1
8	AFDB:P82147	0.639	0.601	3.704E-14	187	0.417	0.390	P82147.pdb.gz	L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster OX=7227 GN=l(2)efl PE=1 SV=1
9	AFDB:P15991	0.515	0.427	9.756E-14	213	0.434	0.357	P15991.pdb.gz	HSPB1_CRILO Heat shock protein beta-1 OS=Cricetulus longicaudatus OX=10030 GN=HSPB1 PE=1 SV=1
10	AFDB:P04792	0.532	0.458	1.033E-13	205	0.400	0.341	P04792.pdb.gz	HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2
11	AFDB:Q00649	0.506	0.461	1.454E-13	193	0.429	0.389	Q00649.pdb.gz	HSPB1_CHICK Heat shock protein beta-1 OS=Gallus gallus OX=9031 GN=HSPB1 PE=2 SV=1
12	PDB:6t1rA	0.438	0.458	3.933E-11	166	0.520	0.548	6t1rA.pdb.gz
13	PDB:6f2rA	0.463	0.619	4.164E-11	130	0.229	0.308	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
14	PDB:5ltwL	0.446	0.770	1.097E-10	100	0.269	0.470	5ltwL.pdb.gz
15	PDB:5ltwG	0.416	0.614	4.823E-10	118	0.280	0.415	5ltwG.pdb.gz
16	PDB:4ydzA	0.439	0.564	8.054E-10	135	0.211	0.274	4ydzA.pdb.gz
17	PDB:6dv5A	0.363	0.352	5.327E-7	181	0.251	0.243	6dv5A.pdb.gz
18	PDB:3w1zB	0.409	0.495	1.325E-6	143	0.154	0.189	3w1zB.pdb.gz
19	PDB:6f2rQ	0.429	0.820	1.403E-6	89	0.166	0.326	6f2rQ.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
20	PDB:1gmeA	0.426	0.487	2.626E-6	150	0.171	0.200	1gmeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02511	6.83e-126	352	175	1.000	1.000	CRYAB_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=CRYAB PE=1 SV=2
2	V9HW27	6.83e-126	352	175	1.000	1.000	V9HW27_HUMAN Alpha-crystallin B chain OS=Homo sapiens OX=9606 GN=HEL-S-101 PE=1 SV=1
3	P02510	2.98e-123	346	175	0.977	0.977	CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus OX=9913 GN=CRYAB PE=1 SV=2
4	P23927	3.12e-123	346	175	0.977	0.977	CRYAB_MOUSE Alpha-crystallin B chain OS=Mus musculus OX=10090 GN=Cryab PE=1 SV=2
5	P23928	3.88e-123	345	175	0.971	0.971	CRYAB_RAT Alpha-crystallin B chain OS=Rattus norvegicus OX=10116 GN=Cryab PE=1 SV=1
6	Q9PUR2	8.90e-68	205	168	0.594	0.619	Q9PUR2_DANRE Alpha b crystallin OS=Danio rerio OX=7955 GN=cryab PE=1 SV=1
7	Q6DG35	8.72e-64	195	165	0.589	0.624	Q6DG35_DANRE Alpha-crystallin B chain OS=Danio rerio OX=7955 GN=cryab2 PE=1 SV=1
8	P02489	2.70e-61	189	173	0.554	0.561	CRYAA_HUMAN Alpha-crystallin A chain OS=Homo sapiens OX=9606 GN=CRYAA PE=1 SV=2
9	P02470	1.40e-60	187	173	0.543	0.549	CRYAA_BOVIN Alpha-crystallin A chain OS=Bos taurus OX=9913 GN=CRYAA PE=1 SV=1
10	Q8UUZ6	2.66e-58	181	173	0.520	0.526	Q8UUZ6_DANRE Alpha A crystallin OS=Danio rerio OX=7955 GN=wu:fc06h04 PE=1 SV=1
11	P24623	3.74e-56	177	196	0.543	0.485	CRYAA_RAT Alpha-crystallin A chain OS=Rattus norvegicus OX=10116 GN=Cryaa PE=1 SV=1
12	P24622	4.18e-56	177	196	0.543	0.485	CRYAA_MOUSE Alpha-crystallin A chain OS=Mus musculus OX=10090 GN=Cryaa PE=2 SV=1
13	P97541	2.79e-43	143	162	0.423	0.457	HSPB6_RAT Heat shock protein beta-6 OS=Rattus norvegicus OX=10116 GN=Hspb6 PE=1 SV=1
14	O14558	2.25e-42	140	160	0.411	0.450	HSPB6_HUMAN Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2
15	V9HWB6	2.25e-42	140	160	0.411	0.450	V9HWB6_HUMAN Epididymis luminal protein 55 OS=Homo sapiens OX=9606 GN=HEL55 PE=2 SV=1
16	E7EWH7	4.01e-38	129	153	0.354	0.405	E7EWH7_HUMAN Crystallin alpha A OS=Homo sapiens OX=9606 GN=CRYAA PE=1 SV=1
17	P14602	8.74e-36	125	209	0.457	0.383	HSPB1_MOUSE Heat shock protein beta-1 OS=Mus musculus OX=10090 GN=Hspb1 PE=1 SV=3
18	P82147	2.38e-35	124	187	0.406	0.380	L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster OX=7227 GN=l(2)efl PE=1 SV=1
19	Q00649	2.87e-35	124	193	0.411	0.373	HSPB1_CHICK Heat shock protein beta-1 OS=Gallus gallus OX=9031 GN=HSPB1 PE=2 SV=1
20	P42930	4.80e-35	123	206	0.451	0.383	HSPB1_RAT Heat shock protein beta-1 OS=Rattus norvegicus OX=10116 GN=Hspb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17886 ArsA_HSP20	81	14.3	HSP20-like domain found in ArsA
2	PF00525 Crystallin	4.2e-24	95.7	Alpha crystallin A chain, N terminal
3	PF00011 HSP20	1.1e-21	88.3	Hsp20/alpha crystallin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433560

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000291554	0.998	Crystallin, alpha A
2	9606.ENSP00000335153	0.974	Heat shock protein HSP 90-alpha
3	9606.ENSP00000264376	0.963	Gamma-crystallin D
4	9606.ENSP00000281938	0.959	Heat shock protein beta-8
5	9606.ENSP00000368752	0.959	Major prion protein
6	9606.ENSP00000254322	0.958	DnaJ homolog subfamily B member 1
7	9606.ENSP00000364802	0.958	Heat shock 70 kDa protein 1A
8	9606.ENSP00000360609	0.950	Heat shock protein HSP 90-beta
9	9606.ENSP00000431512	0.950	Heat shock factor protein 1
10	9606.ENSP00000432083	0.948	Heat shock cognate 71 kDa protein
11	9606.ENSP00000364805	0.947	Heat shock 70 kDa protein 1-like
12	9606.ENSP00000381273	0.946	Beta-crystallin B2
13	9606.ENSP00000482816	0.940	Alpha-crystallin A chain
14	9606.ENSP00000364801	0.939	Heat shock protein family A member 1B
15	9606.ENSP00000338345	0.928	Alpha-synuclein
16	9606.ENSP00000225387	0.927	Beta-crystallin A3
17	9606.ENSP00000376287	0.922	Beta-crystallin S
18	9606.ENSP00000311032	0.919	Caspase-3
19	9606.ENSP00000284981	0.905	Amyloid-beta A4 protein
20	9606.ENSP00000392896	0.903	Heat shock factor-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051082	0.643	unfolded protein binding
GO:0042802	0.606	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0048523	0.990	negative regulation of cellular process
GO:0010941	0.989	regulation of cell death
GO:0043066	0.978	negative regulation of apoptotic process
GO:0050896	0.974	response to stimulus
GO:0032501	0.974	multicellular organismal process
GO:0019222	0.969	regulation of metabolic process
GO:0032502	0.957	developmental process
GO:0048856	0.952	anatomical structure development
GO:0071840	0.935	cellular component organization or biogenesis
GO:0016043	0.934	cellular component organization
GO:0060255	0.900	regulation of macromolecule metabolic process
GO:0051171	0.887	regulation of nitrogen compound metabolic process
GO:0042221	0.877	response to chemical
GO:0006950	0.868	response to stress
GO:0080090	0.857	regulation of primary metabolic process
GO:0052547	0.853	regulation of peptidase activity
GO:0010605	0.848	negative regulation of macromolecule metabolic process
GO:0052548	0.842	regulation of endopeptidase activity
GO:0051172	0.830	negative regulation of nitrogen compound metabolic process
GO:2000116	0.812	regulation of cysteine-type endopeptidase activity
GO:0000302	0.809	response to reactive oxygen species
GO:0065008	0.795	regulation of biological quality
GO:0007275	0.772	multicellular organism development
GO:0051716	0.771	cellular response to stimulus
GO:0045861	0.767	negative regulation of proteolysis
GO:0031323	0.757	regulation of cellular metabolic process
GO:0051128	0.736	regulation of cellular component organization
GO:0042542	0.726	response to hydrogen peroxide
GO:0010468	0.686	regulation of gene expression
GO:0031324	0.672	negative regulation of cellular metabolic process
GO:0010466	0.663	negative regulation of peptidase activity
GO:0009314	0.616	response to radiation
GO:2000117	0.505	negative regulation of cysteine-type endopeptidase activity
GO:0048518	0.503	positive regulation of biological process
GO:0031647	0.430	regulation of protein stability
GO:0032879	0.407	regulation of localization
GO:0048522	0.379	positive regulation of cellular process
GO:0007154	0.312	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.932	cytosol
GO:0005634	0.912	nucleus
GO:0070013	0.812	intracellular organelle lumen
GO:0031981	0.727	nuclear lumen
GO:0016020	0.708	membrane
GO:0071944	0.529	cell periphery
GO:0043232	0.518	intracellular non-membrane-bounded organelle
GO:0005886	0.503	plasma membrane
GO:0032991	0.490	protein-containing complex
GO:0005654	0.433	nucleoplasm
GO:0099080	0.365	supramolecular complex
GO:0099512	0.303	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]