StarFunc result for job id P02533

User Input

>input (472 residues)
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSG
GACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQ
NLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTAT
VDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIE
SLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRK
DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLE
ETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLE
GEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02533	1.000	1.000	4.731E-61	472	1.000	1.000	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
2	AFDB:Q6IFV1	0.634	0.620	2.399E-50	485	0.903	0.878	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
3	AFDB:P08779	0.556	0.555	1.739E-44	473	0.841	0.839	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
4	AFDB:Q6IFU8	0.440	0.477	2.142E-40	433	0.722	0.788	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
5	AFDB:Q9Z2K1	0.578	0.582	3.419E-40	469	0.769	0.774	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
6	AFDB:Q6PVZ1	0.429	0.433	3.787E-39	467	0.682	0.690	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
7	AFDB:P19012	0.496	0.512	4.229E-34	456	0.644	0.667	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
8	AFDB:Q61414	0.607	0.632	1.078E-33	452	0.617	0.644	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
9	AFDB:Q99456	0.464	0.446	2.110E-31	494	0.559	0.534	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
10	AFDB:A1A4E9	0.388	0.398	5.747E-31	458	0.600	0.618	A1A4E9.pdb.gz	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
11	PDB:7egbA	0.060	0.052	7.553E-1	558	0.028	0.023	7egbA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
12	PDB:7eghA	0.054	0.041	1.128	630	0.025	0.019	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:6fhmA	0.051	0.112	2.057	193	0.013	0.031	6fhmA.pdb.gz
14	PDB:2ymwB	0.047	0.034	2.514	685	0.013	0.009	2ymwB.pdb.gz
15	PDB:7utlV	0.085	0.202	3.284	170	0.087	0.241	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
16	PDB:4v60A	0.160	0.104	3.511	812	0.074	0.043	4v60A.pdb.gz
17	PDB:5aj0Ao	0.061	0.231	3.511	105	0.017	0.076	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:3j16A	0.040	0.047	4.012	386	0.006	0.008	3j16A.pdb.gz	Structural basis of highly conserved ribosome recycling in eukaryotes and archaea.
19	PDB:1dw9A	0.050	0.136	4.290	156	0.021	0.064	1dw9A.pdb.gz
20	PDB:6v8oQ	0.049	0.083	4.290	264	0.006	0.011	6v8oQ.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02533	0.0	956	472	1.000	1.000	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
2	P08779	0.0	591	473	0.610	0.609	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
3	Q04695	0.0	602	432	0.636	0.694	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
4	Q61781	0.0	680	484	0.831	0.810	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
5	Q6IFU8	0.0	619	433	0.727	0.792	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
6	Q6IFV1	0.0	689	485	0.833	0.810	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
7	Q6PVZ1	0.0	550	467	0.566	0.572	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
8	Q9QWL7	0.0	616	433	0.725	0.790	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
9	Q9Z2K1	0.0	540	469	0.555	0.559	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
10	P19012	3.07e-171	491	456	0.521	0.539	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
11	P13646	8.23e-171	490	458	0.511	0.526	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
12	P19001	3.16e-170	486	403	0.536	0.628	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
13	Q61414	1.82e-169	486	452	0.521	0.544	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
14	A1A4E9	2.91e-169	486	458	0.506	0.522	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
15	K7ERE3	4.09e-169	484	415	0.500	0.569	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
16	Q63279	1.62e-166	477	403	0.481	0.563	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
17	P08730	8.49e-166	476	437	0.500	0.540	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
18	P08727	4.16e-163	468	400	0.477	0.562	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
19	B1AQ75	8.72e-163	470	473	0.544	0.543	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
20	O76013	3.68e-162	468	467	0.542	0.548	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14362 DUF4407	6.8e+02	10.9	Domain of unknown function (DUF4407)
2	PF00038 Filament	9.2e-118	405.0	Intermediate filament protein
3	PF12688 TPR_5	78	14.9	Tetratrico peptide repeat
4	PF07926 TPR_MLP1_2	2.4	19.6	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000167586

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252242	0.994	Keratin, type II cytoskeletal 5
2	9606.ENSP00000413479	0.886	Keratin, type II cytoskeletal 3
3	9606.ENSP00000370088	0.820	Amelogenin, X isoform
4	9606.ENSP00000263946	0.790	Plakophilin-1
5	9606.ENSP00000357731	0.777	Loricrin
6	9606.ENSP00000301653	0.771	Keratin, type I cytoskeletal 16
7	9606.ENSP00000308452	0.759	Keratin, type I cytoskeletal 17
8	9606.ENSP00000357753	0.757	Involucrin
9	9606.ENSP00000275493	0.732	Epidermal growth factor receptor
10	9606.ENSP00000323856	0.726	Plectin
11	9606.ENSP00000369129	0.696	Desmoplakin
12	9606.ENSP00000357789	0.690	Filaggrin
13	9606.ENSP00000386896	0.689	Integrin alpha-6
14	9606.ENSP00000261769	0.679	Cadherin-1
15	9606.ENSP00000269571	0.677	Receptor tyrosine-protein kinase erbB-2
16	9606.ENSP00000264012	0.671	Cadherin-3
17	9606.ENSP00000264731	0.668	Tumor protein 63
18	9606.ENSP00000325120	0.668	Progesterone receptor
19	9606.ENSP00000398632	0.654	CD44 antigen
20	9606.ENSP00000252252	0.639	Keratin, type II cytoskeletal 6B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.863	structural molecule activity
GO:0005200	0.713	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0048856	0.994	anatomical structure development
GO:0009987	0.993	cellular process
GO:0009888	0.924	tissue development
GO:0008544	0.908	epidermis development
GO:0032501	0.902	multicellular organismal process
GO:0065007	0.873	biological regulation
GO:0050789	0.857	regulation of biological process
GO:0048513	0.832	animal organ development
GO:0050896	0.807	response to stimulus
GO:0050794	0.766	regulation of cellular process
GO:0071840	0.753	cellular component organization or biogenesis
GO:0030855	0.748	epithelial cell differentiation
GO:0016043	0.740	cellular component organization
GO:0045103	0.700	intermediate filament-based process
GO:0006996	0.582	organelle organization
GO:0007010	0.537	cytoskeleton organization
GO:0043588	0.440	skin development
GO:0051716	0.350	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005737	0.992	cytoplasm
GO:0045111	0.987	intermediate filament cytoskeleton
GO:0099512	0.986	supramolecular fiber
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0005882	0.977	intermediate filament
GO:0005634	0.971	nucleus
GO:0005576	0.968	extracellular region
GO:0005829	0.967	cytosol
GO:0045095	0.964	keratin filament
GO:0071944	0.889	cell periphery
GO:0016020	0.877	membrane
GO:0005615	0.851	extracellular space
GO:0070062	0.819	extracellular exosome
GO:0005886	0.702	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]