StarFunc result for job id P02545

User Input

>input (664 residues)
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK
LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQN
CSIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P48678	0.321	0.320	6.951E-77	665	0.965	0.964	P48678.pdb.gz	LMNA_MOUSE Prelamin-A/C OS=Mus musculus OX=10090 GN=Lmna PE=1 SV=2
2	AFDB:P11048	0.313	0.313	9.540E-62	665	0.733	0.732	P11048.pdb.gz	LMNA_XENLA Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=1
3	AFDB:A0A2R8QPG3	0.518	0.510	6.173E-52	675	0.646	0.636	A0A2R8QPG3.pdb.gz
4	AFDB:B3DFN3	0.561	0.628	3.246E-43	583	0.488	0.556	B3DFN3.pdb.gz	B3DFN3_DANRE Lamin-B2 OS=Danio rerio OX=7955 GN=fc15d06 PE=1 SV=1
5	AFDB:Q03252	0.557	0.594	1.016E-42	620	0.468	0.502	Q03252.pdb.gz	LMNB2_HUMAN Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4
6	AFDB:P14733	0.451	0.498	5.624E-42	588	0.477	0.539	P14733.pdb.gz	LMNB1_MOUSE Lamin-B1 OS=Mus musculus OX=10090 GN=Lmnb1 PE=1 SV=3
7	AFDB:P21619	0.534	0.590	3.695E-41	596	0.465	0.518	P21619.pdb.gz	LMNB2_MOUSE Lamin-B2 OS=Mus musculus OX=10090 GN=Lmnb2 PE=1 SV=2
8	AFDB:P08928	0.434	0.459	2.167E-29	622	0.318	0.339	P08928.pdb.gz	LAM0_DROME Lamin Dm0 OS=Drosophila melanogaster OX=7227 GN=Lam PE=1 SV=4
9	AFDB:Q03427	0.416	0.440	4.208E-28	621	0.328	0.351	Q03427.pdb.gz	LAMC_DROME Lamin-C OS=Drosophila melanogaster OX=7227 GN=LamC PE=1 SV=2
10	AFDB:P90900	0.325	0.367	6.852E-24	575	0.221	0.256	P90900.pdb.gz	IFA4_CAEEL Intermediate filament protein ifa-4 OS=Caenorhabditis elegans OX=6239 GN=ifa-4 PE=1 SV=3
11	PDB:3b2dC	0.114	0.349	2.033E-3	139	0.026	0.122	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
12	PDB:3t6qC	0.098	0.309	6.009E-3	139	0.027	0.129	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:5ii5A	0.079	0.099	1.063E-2	476	0.015	0.021	5ii5A.pdb.gz	Structural Basis of Egg Coat-Sperm Recognition at Fertilization.
14	PDB:1yycA	0.095	0.268	1.126E-2	174	0.017	0.063	1yycA.pdb.gz
15	PDB:1xl6A	0.072	0.134	1.991E-2	291	0.027	0.062	1xl6A.pdb.gz
16	PDB:6xwuA	0.058	0.190	2.108E-2	138	0.021	0.101	6xwuA.pdb.gz
17	PDB:3fxiC	0.088	0.277	2.363E-2	140	0.014	0.064	3fxiC.pdb.gz
18	PDB:6z4eA	0.062	0.158	3.523E-2	207	0.014	0.043	6z4eA.pdb.gz
19	PDB:7tysA	0.085	0.136	3.948E-2	361	0.026	0.047	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
20	PDB:1a9vA	0.087	0.280	7.395E-2	129	0.026	0.132	1a9vA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MQX1	0.0	1347	664	1.000	1.000	A0A384MQX1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	B3DFN3	0.0	615	583	0.488	0.556	B3DFN3_DANRE Lamin-B2 OS=Danio rerio OX=7955 GN=fc15d06 PE=1 SV=1
3	B3DKC5	0.0	808	659	0.654	0.659	B3DKC5_DANRE Lamin A OS=Danio rerio OX=7955 GN=cb948 PE=1 SV=1
4	P02545	0.0	1347	664	1.000	1.000	LMNA_HUMAN Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1
5	P11048	0.0	897	665	0.723	0.722	LMNA_XENLA Lamin-A OS=Xenopus laevis OX=8355 GN=lmna PE=2 SV=1
6	P14733	0.0	593	588	0.467	0.527	LMNB1_MOUSE Lamin-B1 OS=Mus musculus OX=10090 GN=Lmnb1 PE=1 SV=3
7	P20700	0.0	585	586	0.462	0.524	LMNB1_HUMAN Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2
8	P21619	0.0	553	596	0.456	0.508	LMNB2_MOUSE Lamin-B2 OS=Mus musculus OX=10090 GN=Lmnb2 PE=1 SV=2
9	P48678	0.0	1297	665	0.967	0.965	LMNA_MOUSE Prelamin-A/C OS=Mus musculus OX=10090 GN=Lmna PE=1 SV=2
10	P48679	0.0	1303	665	0.973	0.971	LMNA_RAT Prelamin-A/C OS=Rattus norvegicus OX=10116 GN=Lmna PE=1 SV=1
11	P70615	0.0	587	587	0.465	0.526	LMNB1_RAT Lamin-B1 OS=Rattus norvegicus OX=10116 GN=Lmnb1 PE=1 SV=3
12	Q03252	0.0	563	620	0.467	0.500	LMNB2_HUMAN Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4
13	Q3BDU5	0.0	853	487	0.660	0.899	Q3BDU5_HUMAN Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1
14	Q90XD7	0.0	806	659	0.652	0.657	Q90XD7_DANRE Lamin OS=Danio rerio OX=7955 GN=wu:fk66d12 PE=1 SV=1
15	P08928	2.66e-115	360	622	0.331	0.354	LAM0_DROME Lamin Dm0 OS=Drosophila melanogaster OX=7227 GN=Lam PE=1 SV=4
16	Q03427	1.32e-105	335	621	0.316	0.338	LAMC_DROME Lamin-C OS=Drosophila melanogaster OX=7227 GN=LamC PE=1 SV=2
17	Q21443	4.25e-61	216	566	0.256	0.300	LMN1_CAEEL Lamin-1 OS=Caenorhabditis elegans OX=6239 GN=lmn-1 PE=1 SV=2
18	P23731	2.43e-60	214	589	0.232	0.261	IFEB_ASCSU Intermediate filament protein B OS=Ascaris suum OX=6253 PE=1 SV=1
19	P90901	1.56e-58	209	575	0.250	0.289	IFA1_CAEEL Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2
20	Q19289	1.56e-55	201	589	0.230	0.260	IFB1_CAEEL Intermediate filament protein ifb-1 OS=Caenorhabditis elegans OX=6239 GN=ifb-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	30	16.3	Autophagy protein 16 (ATG16)
2	PF10473 CENP-F_leu_zip	3.2e+02	12.7	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
3	PF19220 Crescentin	12	16.5	Crescentin protein
4	PF06818 Fez1	13	17.7	Fez1
5	PF00038 Filament	5.9e-95	330.1	Intermediate filament protein
6	PF18455 GBR2_CC	48	15.3	Gamma-aminobutyric acid type B receptor subunit 2 coiled-coil domain
7	PF14932 HAUS-augmin3	29	15.6	HAUS augmin-like complex subunit 3
8	PF00932 LTD	5.6e-15	67.0	Lamin Tail Domain
9	PF04163 Tht1	7e+02	10.4	Tht1-like nuclear fusion protein
10	PF16331 TolA_bind_tri	30	16.1	TolA binding protein trimerisation
11	PF07926 TPR_MLP1_2	0.79	21.2	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357283

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310275	0.999	Barrier-to-autointegration factor
2	9606.ENSP00000358857	0.999	Emerin
3	9606.ENSP00000384015	0.998	SUN domain-containing protein 1
4	9606.ENSP00000266732	0.996	Lamina-associated polypeptide 2, isoform alpha
5	9606.ENSP00000308369	0.996	Inner nuclear membrane protein Man1
6	9606.ENSP00000385616	0.996	SUN domain-containing protein 2
7	9606.ENSP00000356224	0.993	Nesprin-1
8	9606.ENSP00000261366	0.989	Lamin-B1
9	9606.ENSP00000348069	0.988	Sterol regulatory element-binding protein 1
10	9606.ENSP00000350719	0.983	Nesprin-2
11	9606.ENSP00000327054	0.975	Lamin-B2
12	9606.ENSP00000339883	0.975	Lamin-B receptor
13	9606.ENSP00000293760	0.966	LEM domain-containing protein 2
14	9606.ENSP00000306245	0.964	Proto-oncogene c-Fos
15	9606.ENSP00000378699	0.964	Cyclin-dependent kinase 1
16	9606.ENSP00000265164	0.960	Caspase-6
17	9606.ENSP00000256442	0.955	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000408695	0.938	Protein kinase C alpha type
19	9606.ENSP00000361845	0.933	CAAX prenyl protease 1 homolog
20	9606.ENSP00000267163	0.925	Retinoblastoma-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.548	identical protein binding
GO:0005198	0.543	structural molecule activity
GO:0019899	0.382	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0032501	0.919	multicellular organismal process
GO:0048519	0.919	negative regulation of biological process
GO:0032502	0.846	developmental process
GO:0071840	0.773	cellular component organization or biogenesis
GO:0050896	0.762	response to stimulus
GO:0016043	0.759	cellular component organization
GO:0008152	0.716	metabolic process
GO:0048518	0.704	positive regulation of biological process
GO:0019222	0.697	regulation of metabolic process
GO:0006996	0.672	organelle organization
GO:0048856	0.622	anatomical structure development
GO:0060255	0.607	regulation of macromolecule metabolic process
GO:0048522	0.605	positive regulation of cellular process
GO:0044237	0.589	cellular metabolic process
GO:0071704	0.548	organic substance metabolic process
GO:0051179	0.532	localization
GO:0051171	0.486	regulation of nitrogen compound metabolic process
GO:0080090	0.484	regulation of primary metabolic process
GO:0051716	0.470	cellular response to stimulus
GO:0048523	0.470	negative regulation of cellular process
GO:0031323	0.466	regulation of cellular metabolic process
GO:0010468	0.388	regulation of gene expression
GO:0009893	0.379	positive regulation of metabolic process
GO:0048583	0.378	regulation of response to stimulus
GO:0019219	0.376	regulation of nucleobase-containing compound metabolic process
GO:0033036	0.371	macromolecule localization
GO:0051641	0.338	cellular localization
GO:0051234	0.323	establishment of localization
GO:0006950	0.320	response to stress
GO:0044238	0.306	primary metabolic process
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005654	0.997	nucleoplasm
GO:0016020	0.994	membrane
GO:0005635	0.986	nuclear envelope
GO:0043232	0.973	intracellular non-membrane-bounded organelle
GO:0034399	0.949	nuclear periphery
GO:0005829	0.935	cytosol
GO:0031090	0.792	organelle membrane
GO:0005652	0.787	nuclear lamina
GO:0099512	0.720	supramolecular fiber
GO:0032991	0.719	protein-containing complex
GO:0005856	0.678	cytoskeleton
GO:0016604	0.587	nuclear body
GO:0016363	0.526	nuclear matrix
GO:0016607	0.525	nuclear speck
GO:0099513	0.518	polymeric cytoskeletal fiber
GO:0031965	0.511	nuclear membrane
GO:0045111	0.397	intermediate filament cytoskeleton
GO:0005694	0.342	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]