StarFunc result for job id P02549

User Input

>input (2419 residues)
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKR
DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFT
MGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAI
ATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQN
EVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE
GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALAT
SRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEID
SYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQCLDFHL
FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTAT
KLIGDDHYDSENIKAIRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINK
KKKLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTT
RLSEVASLWEELLEATKQKGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLA
EVQNRLRKHGLLESAVAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKE
PLATRKKKLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILE
NIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQ
FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRN
QANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAA
DHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQ
RYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKV
ADDLLFEGLLTPEGAQIRQELNSRWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE
KKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDL
QRQKMELNEAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAED
LTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDL
EKAWEKRKKILDQCLELQMFQGNCDQVESWMVARENSLRSDDKSSLDSLEALMKKRDDLD
KAITAQEGKITDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYA
NLKQFYRDLEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVIN
LGNSLIECSACDGNEEAMKEQLEQLKEHWDHLLERTNDKGKKLNEASRQQRFNTSIRDFE
FWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLAREDALKDLNTLAEDLLSSGTFN
VDQIVKKKDNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQD
YGRDLQGVQNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEH
WEKLKELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMK
HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW
KLQLEDDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSF
QQERLPEITDLKDKLISAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQK
AEDLFVEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFK
CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQ
EFEQNASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLG
DNLEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDIKGVSEETLKEFSTIY
KHFDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYT
AFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG
RSHLSGYDYVGFTNSYFGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A678	0.398	0.399	0.000	2416	0.801	0.802	D4A678.pdb.gz	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
2	AFDB:F1R446	0.395	0.387	0.000	2480	0.554	0.541	F1R446.pdb.gz
3	AFDB:P02549	1.000	1.000	0.000	2419	1.000	1.000	P02549.pdb.gz	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
4	AFDB:P07751	0.495	0.487	0.000	2477	0.560	0.547	P07751.pdb.gz	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
5	AFDB:P13395	0.562	0.563	0.000	2415	0.462	0.463	P13395.pdb.gz	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
6	AFDB:Q21408	0.462	0.461	0.000	2432	0.439	0.437	Q21408.pdb.gz	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
7	AFDB:Q01082	0.125	0.128	5.628E-64	2364	0.189	0.194	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
8	AFDB:Q00963	0.114	0.119	5.899E-64	2291	0.189	0.199	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
9	AFDB:P11277	0.140	0.157	2.632E-62	2137	0.173	0.196	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
10	AFDB:O15020	0.127	0.129	3.654E-62	2390	0.188	0.190	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
11	PDB:1sjjA	0.103	0.244	7.795E-20	863	0.069	0.194	1sjjA.pdb.gz
12	PDB:4d1eA	0.093	0.231	3.037E-19	859	0.074	0.207	4d1eA.pdb.gz
13	PDB:7sqcR1	0.046	0.051	7.624E-6	2080	0.111	0.129	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5m6sA	0.038	0.773	2.691E-4	98	0.029	0.704	5m6sA.pdb.gz
15	PDB:7mq8LM	0.040	0.044	3.246E-4	2005	0.100	0.120	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:2dybA	0.035	0.187	4.507E-4	298	0.015	0.124	2dybA.pdb.gz
17	PDB:1a2xA	0.038	0.424	5.697E-4	158	0.012	0.184	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
18	PDB:5d43A	0.042	0.458	8.689E-4	150	0.013	0.213	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
19	PDB:4bujB	0.043	0.063	9.106E-4	1367	0.086	0.151	4bujB.pdb.gz
20	PDB:7ajuUT	0.048	0.049	1.098E-3	2313	0.117	0.122	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SF54	0.0	2678	2457	0.568	0.559	A0A0D9SF54_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
2	A0A0D9SGF6	0.0	2660	2498	0.568	0.550	A0A0D9SGF6_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
3	A0A384P5S9	0.0	2687	2452	0.568	0.560	A0A384P5S9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	A0A8J8Y4Y9	0.0	1200	2339	0.283	0.292	A0A8J8Y4Y9_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=1
5	A3FG33	0.0	2620	2480	0.560	0.546	A3FG33_DANRE Alpha II-spectrin OS=Danio rerio OX=7955 GN=wu:fa20e05 PE=2 SV=1
6	D4A678	0.0	3885	2415	0.803	0.805	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
7	G4S034	0.0	1967	2427	0.440	0.438	G4S034_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
8	P02549	0.0	4935	2419	1.000	1.000	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
9	P07751	0.0	2650	2477	0.566	0.553	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
10	P08032	0.0	3865	2415	0.804	0.806	SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus OX=10090 GN=Spta1 PE=1 SV=3
11	P13395	0.0	2146	2415	0.465	0.466	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
12	P16086	0.0	2669	2472	0.567	0.555	SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2
13	P16546	0.0	2673	2472	0.568	0.556	SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4
14	Q13813	0.0	2678	2472	0.568	0.556	SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3
15	Q21408	0.0	1964	2432	0.439	0.437	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
16	Q6XDA1	0.0	3800	2385	0.790	0.802	Q6XDA1_RAT Erythroid spectrin alpha OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=1
17	Q7KV70	2.24e-121	434	4207	0.168	0.097	Q7KV70_DROME Karst, isoform C OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
18	A8JNJ6	2.52e-121	434	4337	0.168	0.094	A8JNJ6_DROME Karst, isoform E OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=2
19	M9PBL6	3.45e-121	434	4321	0.168	0.094	M9PBL6_DROME Karst, isoform G OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
20	Q9VZQ3	4.18e-121	433	4097	0.168	0.099	Q9VZQ3_DROME Karst, isoform A OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15464 DUF4633	3.5e+02	12.7	Domain of unknown function (DUF4633)
2	PF00036 EF-hand_1	3.4	18.5	EF hand
3	PF13405 EF-hand_6	0.41	21.6	EF-hand domain
4	PF13499 EF-hand_7	2.9	19.7	EF-hand domain pair
5	PF08726 EFhand_Ca_insen	8.3e-23	91.6	Ca2+ insensitive EF hand
6	PF18288 FAA_hydro_N_2	3.5e+02	13.0	Fumarylacetoacetase N-terminal domain 2
7	PF00018 SH3_1	5.2e-11	53.3	SH3 domain
8	PF17902 SH3_10	72	14.8	SH3 domain
9	PF07653 SH3_2	0.89	20.7	Variant SH3 domain
10	PF08239 SH3_3	6.1e+02	12.2	Bacterial SH3 domain
11	PF14604 SH3_9	1.4e-06	39.5	Variant SH3 domain
12	PF00435 Spectrin	0	1336.5	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451752	0.992	Spectrin beta chain, erythrocytic
2	9606.ENSP00000256078	0.939	GTPase KRas
3	9606.ENSP00000265709	0.939	Ankyrin-1
4	9606.ENSP00000407586	0.933	GTPase HRas
5	9606.ENSP00000358548	0.924	GTPase NRas
6	9606.ENSP00000362680	0.905	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000349259	0.882	Spectrin beta chain, non-erythrocytic 1
8	9606.ENSP00000300215	0.877	Erythrocyte membrane protein band 4.2
9	9606.ENSP00000432568	0.842	Spectrin beta chain, non-erythrocytic 2
10	9606.ENSP00000317790	0.838	Spectrin beta, non-erythrocytic 5
11	9606.ENSP00000360217	0.825	Ammonium transporter Rh type A
12	9606.ENSP00000311032	0.815	Caspase-3
13	9606.ENSP00000361824	0.806	Spectrin alpha chain, non-erythrocytic 1
14	9606.ENSP00000263373	0.805	Spectrin beta chain, non-erythrocytic 4
15	9606.ENSP00000262418	0.797	Band 3 anion transport protein
16	9606.ENSP00000280772	0.777	Ankyrin-3
17	9606.ENSP00000338481	0.770	Band 4.1-like protein 2
18	9606.ENSP00000357106	0.744	Cell adhesion molecule 3
19	9606.ENSP00000369756	0.716	Receptor-type tyrosine-protein phosphatase alpha
20	9606.ENSP00000345259	0.712	Protein 4.1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0044877	0.998	protein-containing complex binding
GO:0005198	0.996	structural molecule activity
GO:0005200	0.992	structural constituent of cytoskeleton
GO:0051015	0.988	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.988	cellular component organization
GO:0006996	0.791	organelle organization
GO:0030029	0.738	actin filament-based process
GO:0030036	0.502	actin cytoskeleton organization
GO:0065007	0.493	biological regulation
GO:0032501	0.472	multicellular organismal process
GO:0050789	0.427	regulation of biological process
GO:0032502	0.385	developmental process
GO:0048856	0.378	anatomical structure development
GO:0050794	0.320	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0005886	0.998	plasma membrane
GO:0043226	0.995	organelle
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0005737	0.979	cytoplasm
GO:0032991	0.977	protein-containing complex
GO:0098562	0.971	cytoplasmic side of membrane
GO:0009898	0.964	cytoplasmic side of plasma membrane
GO:0005829	0.868	cytosol
GO:0043227	0.838	membrane-bounded organelle
GO:0043231	0.814	intracellular membrane-bounded organelle
GO:0005856	0.741	cytoskeleton
GO:0042995	0.730	cell projection
GO:0015629	0.707	actin cytoskeleton
GO:0120025	0.681	plasma membrane bounded cell projection
GO:0005938	0.649	cell cortex
GO:0043005	0.608	neuron projection
GO:0030863	0.583	cortical cytoskeleton
GO:0030424	0.440	axon
GO:0030864	0.365	cortical actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]