StarFunc result for job id P02585

User Input

>input (160 residues)
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02585	1.000	1.000	1.486E-27	160	1.000	1.000	P02585.pdb.gz	TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens OX=9606 GN=TNNC2 PE=1 SV=2
2	AFDB:A0A060WZV7	0.806	0.672	7.615E-23	197	0.787	0.640	A0A060WZV7.pdb.gz	A0A060WZV7_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006413001 PE=4 SV=1
3	PDB:1a2xA	0.434	0.439	6.980E-20	158	0.981	0.994	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
4	AFDB:Q6IQ64	0.884	0.879	8.976E-20	161	0.637	0.634	Q6IQ64.pdb.gz	Q6IQ64_DANRE Slow-specific troponin C OS=Danio rerio OX=7955 GN=stnnc PE=1 SV=1
5	AFDB:A0A060XPN3	0.802	0.797	2.164E-18	161	0.650	0.646	A0A060XPN3.pdb.gz	A0A060XPN3_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007298001 PE=4 SV=1
6	AFDB:P02599	0.491	0.513	5.844E-16	152	0.463	0.487	P02599.pdb.gz	CALM_DICDI Calmodulin OS=Dictyostelium discoideum OX=44689 GN=calA PE=1 SV=3
7	AFDB:P24044	0.514	0.548	7.847E-16	149	0.475	0.510	P24044.pdb.gz	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
8	AFDB:P60204	0.535	0.570	7.847E-16	149	0.444	0.477	P60204.pdb.gz	CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=camA PE=1 SV=2
9	AFDB:O16305	0.522	0.558	8.324E-16	149	0.475	0.510	O16305.pdb.gz	CALM_CAEEL Calmodulin OS=Caenorhabditis elegans OX=6239 GN=cmd-1 PE=1 SV=3
10	AFDB:P05933	0.531	0.564	8.324E-16	150	0.444	0.473	P05933.pdb.gz	CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cam1 PE=1 SV=1
11	AFDB:A0A1D8PMF8	0.693	0.736	1.688E-15	149	0.456	0.490	A0A1D8PMF8.pdb.gz	A0A1D8PMF8_CANAL Calmodulin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CMD1 PE=4 SV=1
12	PDB:5a2hA	0.506	0.546	6.078E-15	147	0.463	0.503	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
13	PDB:1osaA	0.499	0.534	2.357E-14	148	0.481	0.520	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
14	PDB:2f2pA	0.498	0.474	2.652E-14	169	0.469	0.444	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
15	PDB:1ggzA	0.482	0.530	3.777E-14	144	0.406	0.451	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
16	PDB:2jt0A	0.506	0.504	7.662E-14	161	0.644	0.640	2jt0A.pdb.gz
17	PDB:6ya9A	0.449	0.189	1.087E-12	400	0.481	0.193	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
18	PDB:3qrxA	0.494	0.541	1.223E-12	145	0.419	0.462	3qrxA.pdb.gz	The structure, molecular dynamics, and energetics of centrin-melittin complex.
19	PDB:6hr1A	0.446	0.181	1.459E-12	406	0.481	0.190	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:6xyrA	0.442	0.210	1.741E-12	348	0.481	0.221	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02585	5.01e-112	316	160	1.000	1.000	TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens OX=9606 GN=TNNC2 PE=1 SV=2
2	P02586	7.29e-111	313	160	0.994	0.994	TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNC2 PE=1 SV=2
3	A0A060YT85	4.23e-87	253	161	0.794	0.789	A0A060YT85_ONCMY EF-hand domain-containing protein (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020987001 PE=4 SV=1
4	A0A060WZV7	2.63e-86	253	197	0.787	0.640	A0A060WZV7_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006413001 PE=4 SV=1
5	Q9I8U8	2.07e-74	221	160	0.787	0.787	Q9I8U8_DANRE Fast skeletal muscle troponin C OS=Danio rerio OX=7955 GN=tnnc PE=1 SV=1
6	A0A060XPN3	1.84e-65	199	161	0.650	0.646	A0A060XPN3_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00007298001 PE=4 SV=1
7	P63315	4.48e-65	197	161	0.656	0.652	TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus OX=9913 GN=TNNC1 PE=1 SV=1
8	P19123	1.06e-64	197	161	0.650	0.646	TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus OX=10090 GN=Tnnc1 PE=1 SV=1
9	Q4PP99	1.06e-64	197	161	0.650	0.646	Q4PP99_RAT Cardiac troponin C OS=Rattus norvegicus OX=10116 GN=Tnnc1 PE=2 SV=1
10	P63316	1.40e-64	196	161	0.650	0.646	TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens OX=9606 GN=TNNC1 PE=1 SV=1
11	Q800V7	1.56e-64	196	161	0.637	0.634	Q800V7_DANRE Cardiac troponin C OS=Danio rerio OX=7955 GN=cTnC PE=1 SV=1
12	A0A8J8XJV6	2.15e-64	196	156	0.631	0.647	A0A8J8XJV6_RAT Troponin C1, slow skeletal and cardiac type OS=Rattus norvegicus OX=10116 GN=Tnnc1 PE=4 SV=1
13	Q7ZZB9	5.92e-64	195	161	0.637	0.634	Q7ZZB9_ONCMY Troponin C OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00056460001 PE=1 SV=1
14	Q5XJB2	8.78e-64	194	161	0.631	0.627	Q5XJB2_DANRE Tnnc1 protein OS=Danio rerio OX=7955 GN=tnnc1 PE=2 SV=1
15	A0A8I6A4Q5	5.36e-63	192	155	0.613	0.632	A0A8I6A4Q5_RAT Troponin C1, slow skeletal and cardiac type OS=Rattus norvegicus OX=10116 GN=Tnnc1 PE=4 SV=1
16	Q6IQ64	6.94e-57	177	161	0.637	0.634	Q6IQ64_DANRE Slow-specific troponin C OS=Danio rerio OX=7955 GN=stnnc PE=1 SV=1
17	B4DJ51	1.34e-48	155	149	0.481	0.517	B4DJ51_HUMAN Calmodulin 1 (Phosphorylase kinase, delta), isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-72 PE=1 SV=1
18	P0DP23	1.34e-48	155	149	0.481	0.517	CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1
19	P0DP24	1.34e-48	155	149	0.481	0.517	CALM2_HUMAN Calmodulin-2 OS=Homo sapiens OX=9606 GN=CALM2 PE=1 SV=1
20	P0DP25	1.34e-48	155	149	0.481	0.517	CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	6.3	18.2	Caleosin related protein
2	PF07308 DUF1456	2.4	19.9	Protein of unknown function (DUF1456)
3	PF08044 DUF1707	5.2e+02	12.1	Domain of unknown function (DUF1707)
4	PF04391 DUF533	5.4e+02	11.5	Protein of unknown function (DUF533)
5	PF17743 DUF5580	21	15.1	Family of unknown function (DUF5580)
6	PF00036 EF-hand_1	2.1e-27	103.6	EF hand
7	PF08976 EF-hand_11	2.7	20.3	EF-hand domain
8	PF12763 EF-hand_4	0.00052	31.3	Cytoskeletal-regulatory complex EF hand
9	PF13202 EF-hand_5	2.8e-19	78.8	EF hand
10	PF13405 EF-hand_6	1.2e-20	82.5	EF-hand domain
11	PF13499 EF-hand_7	3.1e-29	112.6	EF-hand domain pair
12	PF13833 EF-hand_8	9.2e-22	87.9	EF-hand domain pair
13	PF14658 EF-hand_9	6.4e-13	60.2	EF-hand domain
14	PF11838 ERAP1_C	1.3e+02	13.4	ERAP1-like C-terminal domain
15	PF03963 FlgD	95	14.6	Flagellar hook capping protein - N-terminal region
16	PF05517 p25-alpha	78	14.9	p25-alpha
17	PF10591 SPARC_Ca_bdg	0.012	27.3	Secreted protein acidic and rich in cysteine Ca binding region
18	PF13623 SurA_N_2	3.5e+02	12.5	SurA N-terminal domain
19	PF05099 TerB	1.6	20.4	Tellurite resistance protein TerB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008251

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016196	0.999	Uncharacterized protein
2	61853.ENSNLEP00000008756	0.997	Myosin, light chain 1, alkali
3	61853.ENSNLEP00000016197	0.993	Troponin T type 3 (skeletal, fast)
4	61853.ENSNLEP00000021963	0.967	Troponin T type 2 (cardiac)
5	61853.ENSNLEP00000019171	0.935	Myosin light chain, phosphorylatable, fast skeletal muscle
6	61853.ENSNLEP00000013583	0.933	Uncharacterized protein
7	61853.ENSNLEP00000013175	0.931	Troponin I type 3 (cardiac)
8	61853.ENSNLEP00000008703	0.912	Troponin C1, slow skeletal and cardiac type
9	61853.ENSNLEP00000021966	0.882	Troponin I type 1 (skeletal, slow)
10	61853.ENSNLEP00000015499	0.881	PDZ and LIM domain 7 (enigma)
11	61853.ENSNLEP00000012455	0.860	Myosin, heavy chain 1, skeletal muscle, adult
12	61853.ENSNLEP00000007481	0.858	Uncharacterized protein
13	61853.ENSNLEP00000007519	0.858	Uncharacterized protein
14	61853.ENSNLEP00000024308	0.858	Uncharacterized protein
15	61853.ENSNLEP00000017442	0.848	Actin, alpha 1, skeletal muscle
16	61853.ENSNLEP00000012429	0.844	Myosin, heavy chain 4, skeletal muscle
17	61853.ENSNLEP00000013734	0.844	Calcium-transporting ATPase
18	61853.ENSNLEP00000007490	0.840	Actinin, alpha 3 (gene/pseudogene)
19	61853.ENSNLEP00000013717	0.838	PDZ and LIM domain 3
20	61853.ENSNLEP00000011927	0.810	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0005509	0.887	calcium ion binding
GO:0003779	0.726	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.917	multicellular organismal process
GO:0065007	0.910	biological regulation
GO:0050789	0.840	regulation of biological process
GO:0006936	0.786	muscle contraction
GO:0006941	0.587	striated muscle contraction
GO:0050896	0.458	response to stimulus
GO:0009987	0.431	cellular process
GO:0050879	0.383	multicellular organismal movement
GO:0048856	0.334	anatomical structure development
GO:0050794	0.313	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030016	0.999	myofibril
GO:0032991	0.992	protein-containing complex
GO:0005829	0.984	cytosol
GO:0036379	0.976	myofilament
GO:0030017	0.925	sarcomere
GO:0005856	0.888	cytoskeleton
GO:0015629	0.883	actin cytoskeleton
GO:0005861	0.527	troponin complex
GO:0043227	0.517	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]