StarFunc result for job id P02647

User Input

>input (267 residues)
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02647	1.000	1.000	3.570E-35	267	1.000	1.000	P02647.pdb.gz	APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1
2	AFDB:P09809	0.526	0.528	1.365E-26	266	0.801	0.805	P09809.pdb.gz	APOA1_RABIT Apolipoprotein A-I OS=Oryctolagus cuniculus OX=9986 GN=APOA1 PE=1 SV=2
3	AFDB:P18648	0.422	0.425	2.338E-26	265	0.809	0.815	P18648.pdb.gz	APOA1_PIG Apolipoprotein A-I OS=Sus scrofa OX=9823 GN=APOA1 PE=1 SV=4
4	AFDB:Q00623	0.435	0.440	3.493E-22	264	0.652	0.659	Q00623.pdb.gz	APOA1_MOUSE Apolipoprotein A-I OS=Mus musculus OX=10090 GN=Apoa1 PE=1 SV=2
5	AFDB:G5BQH5	0.315	0.318	3.020E-20	264	0.648	0.655	G5BQH5.pdb.gz	APOA1_HETGA Apolipoprotein A-I OS=Heterocephalus glaber OX=10181 GN=Apoa1 PE=1 SV=2
6	AFDB:P04639	0.439	0.451	3.261E-20	259	0.625	0.645	P04639.pdb.gz	APOA1_RAT Apolipoprotein A-I OS=Rattus norvegicus OX=10116 GN=Apoa1 PE=1 SV=2
7	AFDB:O42363	0.359	0.364	4.706E-6	262	0.255	0.260	O42363.pdb.gz	APOA1_DANRE Apolipoprotein A-I OS=Danio rerio OX=7955 GN=apoa1 PE=1 SV=1
8	AFDB:P06727	0.212	0.161	1.020E-4	396	0.191	0.129	P06727.pdb.gz	APOA4_HUMAN Apolipoprotein A-IV OS=Homo sapiens OX=9606 GN=APOA4 PE=1 SV=4
9	AFDB:P02651	0.287	0.204	3.768E-4	391	0.176	0.120	P02651.pdb.gz	APOA4_RAT Apolipoprotein A-IV OS=Rattus norvegicus OX=10116 GN=Apoa4 PE=1 SV=2
10	AFDB:P06728	0.239	0.170	6.002E-3	395	0.184	0.124	P06728.pdb.gz	APOA4_MOUSE Apolipoprotein A-IV OS=Mus musculus OX=10090 GN=Apoa4 PE=1 SV=3
11	PDB:7lbmo	0.122	0.243	4.013	108	0.064	0.157	7lbmo.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
12	PDB:7c4jH	0.103	0.112	4.680	242	0.064	0.070	7c4jH.pdb.gz
13	PDB:7mq9SI	0.103	0.042	4.680	844	0.037	0.012	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5y88V	0.082	0.224	5.054	91	0.049	0.143	5y88V.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
15	PDB:3j6b2	0.090	0.202	5.894	113	0.049	0.115	3j6b2.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
16	PDB:7yyhK	0.113	0.133	6.874	217	0.101	0.124	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
17	PDB:5mqfL	0.131	0.106	7.423	336	0.082	0.065	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
18	PDB:2wvrB	0.119	0.310	8.016	74	0.041	0.149	2wvrB.pdb.gz
19	PDB:6elzJ	0.116	0.201	8.016	145	0.049	0.090	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02647	0.0	537	267	1.000	1.000	APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1
2	P18648	4.25e-156	436	265	0.809	0.815	APOA1_PIG Apolipoprotein A-I OS=Sus scrofa OX=9823 GN=APOA1 PE=1 SV=4
3	P09809	1.11e-154	433	266	0.801	0.805	APOA1_RABIT Apolipoprotein A-I OS=Oryctolagus cuniculus OX=9986 GN=APOA1 PE=1 SV=2
4	Q00623	1.30e-115	334	264	0.652	0.659	APOA1_MOUSE Apolipoprotein A-I OS=Mus musculus OX=10090 GN=Apoa1 PE=1 SV=2
5	P04639	2.01e-114	331	259	0.625	0.645	APOA1_RAT Apolipoprotein A-I OS=Rattus norvegicus OX=10116 GN=Apoa1 PE=1 SV=2
6	G5BQH5	9.95e-113	327	264	0.648	0.655	APOA1_HETGA Apolipoprotein A-I OS=Heterocephalus glaber OX=10181 GN=Apoa1 PE=1 SV=2
7	P08250	3.88e-90	269	264	0.494	0.500	APOA1_CHICK Apolipoprotein A-I OS=Gallus gallus OX=9031 GN=APOA1 PE=1 SV=2
8	P02651	3.78e-22	96.7	391	0.236	0.161	APOA4_RAT Apolipoprotein A-IV OS=Rattus norvegicus OX=10116 GN=Apoa4 PE=1 SV=2
9	P06727	1.35e-20	92.0	396	0.251	0.169	APOA4_HUMAN Apolipoprotein A-IV OS=Homo sapiens OX=9606 GN=APOA4 PE=1 SV=4
10	O42363	3.04e-20	89.4	262	0.232	0.237	APOA1_DANRE Apolipoprotein A-I OS=Danio rerio OX=7955 GN=apoa1 PE=1 SV=1
11	P06728	1.31e-19	89.4	395	0.228	0.154	APOA4_MOUSE Apolipoprotein A-IV OS=Mus musculus OX=10090 GN=Apoa4 PE=1 SV=3
12	O57523	4.26e-18	83.6	262	0.232	0.237	APA11_ONCMY Apolipoprotein A-I-1 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	E3TE55	3.45e-13	69.7	258	0.191	0.198	E3TE55_ICTPU Apolipoprotein A-I OS=Ictalurus punctatus OX=7998 GN=APOA1 PE=2 SV=1
14	Q6Q788	2.47e-09	59.3	366	0.217	0.158	APOA5_HUMAN Apolipoprotein A-V OS=Homo sapiens OX=9606 GN=APOA5 PE=1 SV=1
15	P08226	1.77e-08	56.6	311	0.262	0.225	APOE_MOUSE Apolipoprotein E OS=Mus musculus OX=10090 GN=Apoe PE=1 SV=2
16	Q98SI3	1.87e-08	55.1	174	0.150	0.230	Q98SI3_CYPCA Apolipoprotein A-I (Fragment) OS=Cyprinus carpio OX=7962 GN=apoA1 PE=2 SV=1
17	Q8C7G5	6.99e-08	55.1	368	0.165	0.120	APOA5_MOUSE Apolipoprotein A-V OS=Mus musculus OX=10090 GN=Apoa5 PE=1 SV=1
18	Q9QUH3	4.49e-07	52.4	367	0.154	0.112	APOA5_RAT Apolipoprotein A-V OS=Rattus norvegicus OX=10116 GN=Apoa5 PE=1 SV=1
19	P02650	6.52e-06	48.9	312	0.176	0.151	APOE_RAT Apolipoprotein E OS=Rattus norvegicus OX=10116 GN=Apoe PE=1 SV=2
20	F1MMT2	0.001	42.4	1964	0.131	0.018	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04691 ApoC-I	0.78	21.0	Apolipoprotein C-I (ApoC-1)
2	PF01442 Apolipoprotein	3.9e-55	198.2	Apolipoprotein A1/A4/E domain
3	PF07464 ApoLp-III	0.076	24.6	Apolipophorin-III precursor (apoLp-III)
4	PF04513 Baculo_PEP_C	17	16.9	Baculovirus polyhedron envelope protein, PEP, C terminus
5	PF10079 BshC	6.3e+02	10.5	Bacillithiol biosynthesis BshC
6	PF07798 CCDC90-like	0.44	22.0	Coiled-coil domain-containing protein 90-like
7	PF08385 DHC_N1	0.65	20.3	Dynein heavy chain, N-terminal region 1
8	PF20421 DHR-2_Lobe_C	2.2e+02	13.1	DHR-2, Lobe C
9	PF11445 DUF2894	37	16.2	Protein of unknown function (DUF2894)
10	PF12277 DUF3618	4.2e+02	12.6	Protein of unknown function (DUF3618)
11	PF13200 DUF4015	2e+02	12.5	Putative glycosyl hydrolase domain
12	PF04286 DUF445	43	15.4	Protein of unknown function (DUF445)
13	PF14643 DUF4455	1.8	18.7	Domain of unknown function (DUF4455)
14	PF19508 DUF6042	8.7	17.4	Family of unknown function (DUF6042)
15	PF06103 DUF948	5.4	18.7	Bacterial protein of unknown function (DUF948)
16	PF02601 Exonuc_VII_L	0.084	24.0	Exonuclease VII, large subunit
17	PF19745 FUT8_N_cat	1.5e+02	12.6	Alpha-(1,6)-fucosyltransferase N- and catalytic domains
18	PF05823 Gp-FAR-1	59	15.5	Nematode fatty acid retinoid binding protein (Gp-FAR-1)
19	PF07902 Gp58	12	15.8	gp58-like protein
20	PF03037 KMP11	6.3e+02	12.6	Kinetoplastid membrane protein 11

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227667	0.999	Apolipoprotein C-III
2	9606.ENSP00000264005	0.999	Phosphatidylcholine-sterol acyltransferase
3	9606.ENSP00000356969	0.999	Apolipoprotein A-II
4	9606.ENSP00000363868	0.999	ATP-binding cassette sub-family A member 1
5	9606.ENSP00000417138	0.999	Phospholipid transfer protein
6	9606.ENSP00000233242	0.998	Apolipoprotein B-100
7	9606.ENSP00000222381	0.997	Serum paraoxonase/arylesterase 1
8	9606.ENSP00000252486	0.997	Apolipoprotein E
9	9606.ENSP00000261693	0.997	Scavenger receptor class B member 1
10	9606.ENSP00000348170	0.997	Haptoglobin
11	9606.ENSP00000317674	0.996	Apolipoprotein L1
12	9606.ENSP00000315130	0.995	Clusterin
13	9606.ENSP00000321334	0.995	Apolipoprotein(a)
14	9606.ENSP00000466775	0.992	Apolipoprotein C-II
15	9606.ENSP00000205948	0.989	Beta-2-glycoprotein 1
16	9606.ENSP00000295897	0.987	Serum albumin
17	9606.ENSP00000367064	0.986	Cubilin
18	9606.ENSP00000427679	0.982	Microsomal triglyceride transfer protein large subunit
19	9606.ENSP00000295834	0.980	Fatty acid-binding protein, liver
20	9606.ENSP00000309757	0.980	Lipoprotein lipase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	0.999	lipid binding
GO:0140677	0.998	molecular function activator activity
GO:0005102	0.998	signaling receptor binding
GO:0001540	0.998	amyloid-beta binding
GO:0120020	0.998	cholesterol transfer activity
GO:0030234	0.997	enzyme regulator activity
GO:0042802	0.995	identical protein binding
GO:0036094	0.990	small molecule binding
GO:0015485	0.978	cholesterol binding
GO:0008047	0.977	enzyme activator activity
GO:0030546	0.967	signaling receptor activator activity
GO:0031072	0.959	heat shock protein binding
GO:0005543	0.959	phospholipid binding
GO:0070325	0.959	lipoprotein particle receptor binding
GO:0048018	0.958	receptor ligand activity
GO:0019899	0.947	enzyme binding
GO:0045499	0.563	chemorepellent activity
GO:0060228	0.558	phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0034190	0.527	apolipoprotein receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0050896	0.981	response to stimulus
GO:0032501	0.977	multicellular organismal process
GO:0044238	0.973	primary metabolic process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0033036	0.964	macromolecule localization
GO:0048518	0.961	positive regulation of biological process
GO:1901564	0.961	organonitrogen compound metabolic process
GO:0080090	0.945	regulation of primary metabolic process
GO:0015918	0.940	sterol transport
GO:0032502	0.938	developmental process
GO:0051239	0.935	regulation of multicellular organismal process
GO:0051049	0.933	regulation of transport
GO:0015748	0.929	organophosphate ester transport
GO:0055092	0.927	sterol homeostasis
GO:0006629	0.923	lipid metabolic process
GO:0048522	0.921	positive regulation of cellular process
GO:0071827	0.921	plasma lipoprotein particle organization
GO:0044237	0.917	cellular metabolic process
GO:1905952	0.914	regulation of lipid localization
GO:0009893	0.908	positive regulation of metabolic process
GO:0048856	0.894	anatomical structure development
GO:0030301	0.882	cholesterol transport
GO:0065009	0.881	regulation of molecular function
GO:0048523	0.874	negative regulation of cellular process
GO:0032368	0.867	regulation of lipid transport
GO:0032374	0.859	regulation of cholesterol transport
GO:0097006	0.855	regulation of plasma lipoprotein particle levels
GO:0008202	0.851	steroid metabolic process
GO:0042632	0.842	cholesterol homeostasis
GO:0042221	0.839	response to chemical
GO:0019216	0.837	regulation of lipid metabolic process
GO:0044281	0.827	small molecule metabolic process
GO:0051050	0.826	positive regulation of transport
GO:0051716	0.823	cellular response to stimulus
GO:0050790	0.799	regulation of catalytic activity
GO:0016125	0.784	sterol metabolic process
GO:0010468	0.768	regulation of gene expression
GO:0009966	0.767	regulation of signal transduction
GO:0045834	0.762	positive regulation of lipid metabolic process
GO:0002682	0.750	regulation of immune system process
GO:1902652	0.747	secondary alcohol metabolic process
GO:0051336	0.745	regulation of hydrolase activity
GO:1902531	0.745	regulation of intracellular signal transduction
GO:1905954	0.741	positive regulation of lipid localization
GO:0045596	0.734	negative regulation of cell differentiation
GO:0015914	0.733	phospholipid transport
GO:0009892	0.732	negative regulation of metabolic process
GO:0048585	0.730	negative regulation of response to stimulus
GO:0051241	0.729	negative regulation of multicellular organismal process
GO:0032101	0.727	regulation of response to external stimulus
GO:0046578	0.717	regulation of Ras protein signal transduction
GO:0032373	0.713	positive regulation of sterol transport
GO:0046486	0.706	glycerolipid metabolic process
GO:0051128	0.701	regulation of cellular component organization
GO:0009058	0.692	biosynthetic process
GO:0030154	0.689	cell differentiation
GO:0043170	0.685	macromolecule metabolic process
GO:0001817	0.682	regulation of cytokine production
GO:1902903	0.672	regulation of supramolecular fiber organization
GO:0048584	0.658	positive regulation of response to stimulus
GO:0031323	0.648	regulation of cellular metabolic process
GO:0010605	0.647	negative regulation of macromolecule metabolic process
GO:0046470	0.641	phosphatidylcholine metabolic process
GO:0010874	0.631	regulation of cholesterol efflux
GO:0051130	0.624	positive regulation of cellular component organization
GO:0010810	0.590	regulation of cell-substrate adhesion
GO:0009967	0.579	positive regulation of signal transduction
GO:0009968	0.573	negative regulation of signal transduction
GO:0035023	0.571	regulation of Rho protein signal transduction
GO:1901576	0.563	organic substance biosynthetic process
GO:0008203	0.557	cholesterol metabolic process
GO:0009605	0.552	response to external stimulus
GO:0032231	0.548	regulation of actin filament bundle assembly
GO:0010629	0.546	negative regulation of gene expression
GO:0019218	0.543	regulation of steroid metabolic process
GO:0051496	0.542	positive regulation of stress fiber assembly
GO:1900024	0.509	regulation of substrate adhesion-dependent cell spreading
GO:0045785	0.508	positive regulation of cell adhesion
GO:0001959	0.505	regulation of cytokine-mediated signaling pathway
GO:0032376	0.502	positive regulation of cholesterol transport
GO:2000026	0.499	regulation of multicellular organismal development
GO:0010803	0.465	regulation of tumor necrosis factor-mediated signaling pathway
GO:0001960	0.459	negative regulation of cytokine-mediated signaling pathway
GO:0046579	0.457	positive regulation of Ras protein signal transduction
GO:0051171	0.453	regulation of nitrogen compound metabolic process
GO:0035025	0.441	positive regulation of Rho protein signal transduction
GO:0032652	0.440	regulation of interleukin-1 production
GO:0044093	0.421	positive regulation of molecular function
GO:0062012	0.419	regulation of small molecule metabolic process
GO:0010811	0.416	positive regulation of cell-substrate adhesion
GO:0080134	0.398	regulation of response to stress
GO:1901566	0.393	organonitrogen compound biosynthetic process
GO:1900026	0.388	positive regulation of substrate adhesion-dependent cell spreading
GO:0032692	0.388	negative regulation of interleukin-1 production
GO:0009889	0.387	regulation of biosynthetic process
GO:0019538	0.373	protein metabolic process
GO:0045940	0.367	positive regulation of steroid metabolic process
GO:0044249	0.360	cellular biosynthetic process
GO:0065008	0.356	regulation of biological quality
GO:0051129	0.335	negative regulation of cellular component organization
GO:0032102	0.334	negative regulation of response to external stimulus
GO:0007165	0.333	signal transduction
GO:0060627	0.332	regulation of vesicle-mediated transport
GO:0008610	0.329	lipid biosynthetic process
GO:0043085	0.317	positive regulation of catalytic activity
GO:0051240	0.315	positive regulation of multicellular organismal process
GO:0010604	0.300	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0012505	0.994	endomembrane system
GO:0070013	0.993	intracellular organelle lumen
GO:0032991	0.985	protein-containing complex
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0005737	0.975	cytoplasm
GO:0071944	0.942	cell periphery
GO:0005829	0.927	cytosol
GO:0031982	0.918	vesicle
GO:0070062	0.881	extracellular exosome
GO:0031410	0.857	cytoplasmic vesicle
GO:0005783	0.851	endoplasmic reticulum
GO:0016020	0.832	membrane
GO:0034358	0.718	plasma lipoprotein particle
GO:0005886	0.614	plasma membrane
GO:0034364	0.609	high-density lipoprotein particle
GO:0034361	0.583	very-low-density lipoprotein particle
GO:0005768	0.518	endosome
GO:0005788	0.516	endoplasmic reticulum lumen
GO:0072562	0.513	blood microparticle
GO:0031012	0.508	extracellular matrix
GO:0060205	0.498	cytoplasmic vesicle lumen
GO:0034774	0.482	secretory granule lumen
GO:0030139	0.481	endocytic vesicle
GO:0005769	0.458	early endosome
GO:0071682	0.401	endocytic vesicle lumen
GO:0062023	0.390	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.998	cholesterol(in) = cholesterol(out)

[back to server]