StarFunc result for job id P02652

User Input

>input (100 residues)
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02652	1.000	1.000	2.550E-14	100	1.000	1.000	P02652.pdb.gz	APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1
2	AFDB:P09813	0.790	0.777	2.507E-9	102	0.630	0.618	P09813.pdb.gz	APOA2_MOUSE Apolipoprotein A-II OS=Mus musculus OX=10090 GN=Apoa2 PE=1 SV=2
3	AFDB:P04638	0.742	0.730	4.426E-7	102	0.560	0.549	P04638.pdb.gz	APOA2_RAT Apolipoprotein A-II OS=Rattus norvegicus OX=10116 GN=Apoa2 PE=2 SV=1
4	AFDB:Q9VVH3	0.265	0.226	3.983	122	0.190	0.156	Q9VVH3.pdb.gz	MIC13_DROME MICOS complex subunit MIC13 homolog QIL1 OS=Drosophila melanogaster OX=7227 GN=QIL1 PE=2 SV=1
5	AFDB:Q96EE4	0.376	0.292	4.694	140	0.150	0.107	Q96EE4.pdb.gz	CC126_HUMAN Coiled-coil domain-containing protein 126 OS=Homo sapiens OX=9606 GN=CCDC126 PE=2 SV=2
6	AFDB:Q9C509	0.295	0.078	6.519	544	0.160	0.029	Q9C509.pdb.gz	SGPL_ARATH Sphingosine-1-phosphate lyase OS=Arabidopsis thaliana OX=3702 GN=DPL1 PE=1 SV=1
7	AFDB:Q9EQ09	0.278	0.091	9.053	363	0.200	0.055	Q9EQ09.pdb.gz	OLR1_MOUSE Oxidized low-density lipoprotein receptor 1 OS=Mus musculus OX=10090 GN=Olr1 PE=2 SV=2
8	AFDB:P02655	0.441	0.437	9.828	101	0.160	0.158	P02655.pdb.gz	APOC2_HUMAN Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02652	4.35e-68	200	100	1.000	1.000	APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1
2	P09813	3.76e-42	135	102	0.630	0.618	APOA2_MOUSE Apolipoprotein A-II OS=Mus musculus OX=10090 GN=Apoa2 PE=1 SV=2
3	P04638	5.37e-36	119	102	0.560	0.549	APOA2_RAT Apolipoprotein A-II OS=Rattus norvegicus OX=10116 GN=Apoa2 PE=2 SV=1
4	Q4L216	4.39e-06	44.3	130	0.280	0.215	Q4L216_DANRE Antifreeze protein type IV OS=Danio rerio OX=7955 GN=fa18f02 PE=1 SV=1
5	E9QGU7	2.63e-05	42.0	129	0.300	0.233	E9QGU7_DANRE Antifreeze protein type IV OS=Danio rerio OX=7955 GN=LOC568656 PE=4 SV=1
6	P11598	0.80	30.4	505	0.170	0.034	PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus OX=10116 GN=Pdia3 PE=1 SV=2
7	P27773	1.2	30.0	505	0.170	0.034	PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus OX=10090 GN=Pdia3 PE=1 SV=2
8	P33892	1.3	30.0	2672	0.150	0.006	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
9	P30101	2.1	29.3	505	0.160	0.032	PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4
10	Q4VIT4	2.1	29.3	505	0.160	0.032	PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops OX=9534 GN=PDIA3 PE=1 SV=1
11	V9HVY3	2.1	29.3	505	0.160	0.032	V9HVY3_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=HEL-S-269 PE=2 SV=1
12	B7G7S4	3.0	28.9	2092	0.160	0.008	B7G7S4_PHATC acetyl-CoA carboxylase OS=Phaeodactylum tricornutum (strain CCAP 1055/1) OX=556484 GN=ACC1 PE=4 SV=1
13	Q8MRH3	3.9	28.5	291	0.180	0.062	Q8MRH3_DROME LP01553p OS=Drosophila melanogaster OX=7227 GN=St3 PE=2 SV=1
14	F1QHZ6	4.3	28.5	778	0.160	0.021	DNAI4_DANRE Dynein axonemal intermediate chain 4 OS=Danio rerio OX=7955 GN=dnai4 PE=2 SV=1
15	A2AT37	5.1	28.1	1269	0.180	0.014	RENT2_MOUSE Regulator of nonsense transcripts 2 OS=Mus musculus OX=10090 GN=Upf2 PE=1 SV=1
16	E9PVD1	7.7	27.7	701	0.170	0.024	CCD62_MOUSE Coiled-coil domain-containing protein 62 OS=Mus musculus OX=10090 GN=Ccdc62 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04711 ApoA-II	1.4e-45	165.1	Apolipoprotein A-II (ApoA-II)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356969

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236850	0.999	Apolipoprotein A-I
2	9606.ENSP00000233242	0.996	Apolipoprotein B-100
3	9606.ENSP00000227667	0.994	Apolipoprotein C-III
4	9606.ENSP00000252486	0.994	Apolipoprotein E
5	9606.ENSP00000321334	0.983	Apolipoprotein(a)
6	9606.ENSP00000205948	0.982	Beta-2-glycoprotein 1
7	9606.ENSP00000466775	0.981	Apolipoprotein C-II
8	9606.ENSP00000445002	0.972	Apolipoprotein A-V
9	9606.ENSP00000345179	0.966	Apolipoprotein D
10	9606.ENSP00000309757	0.965	Lipoprotein lipase
11	9606.ENSP00000417138	0.962	Phospholipid transfer protein
12	9606.ENSP00000393887	0.957	Alpha-2-HS-glycoprotein
13	9606.ENSP00000385523	0.954	Peroxisome proliferator-activated receptor alpha
14	9606.ENSP00000465356	0.954	Apolipoprotein C-I
15	9606.ENSP00000295834	0.952	Fatty acid-binding protein, liver
16	9606.ENSP00000348170	0.951	Haptoglobin
17	9606.ENSP00000427679	0.948	Microsomal triglyceride transfer protein large subunit
18	9606.ENSP00000264005	0.946	Phosphatidylcholine-sterol acyltransferase
19	9606.ENSP00000200676	0.945	Cholesteryl ester transfer protein
20	9606.ENSP00000350425	0.939	Apolipoprotein A-IV

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	0.999	protein dimerization activity
GO:0008047	0.999	enzyme activator activity
GO:0120020	0.999	cholesterol transfer activity
GO:0031210	0.999	phosphatidylcholine binding
GO:0015485	0.999	cholesterol binding
GO:0005102	0.997	signaling receptor binding
GO:0042802	0.995	identical protein binding
GO:0019899	0.994	enzyme binding
GO:0070325	0.994	lipoprotein particle receptor binding
GO:0140678	0.990	molecular function inhibitor activity
GO:0031072	0.987	heat shock protein binding
GO:0046982	0.928	protein heterodimerization activity
GO:0004857	0.918	enzyme inhibitor activity
GO:0042803	0.904	protein homodimerization activity
GO:0034190	0.433	apolipoprotein receptor binding
GO:0070653	0.417	high-density lipoprotein particle receptor binding
GO:0060228	0.403	phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0055102	0.397	lipase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0051179	0.991	localization
GO:0009987	0.991	cellular process
GO:0050789	0.989	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0006629	0.972	lipid metabolic process
GO:0010876	0.966	lipid localization
GO:0055092	0.964	sterol homeostasis
GO:0006869	0.957	lipid transport
GO:0042632	0.954	cholesterol homeostasis
GO:0050896	0.942	response to stimulus
GO:0009892	0.942	negative regulation of metabolic process
GO:0032501	0.939	multicellular organismal process
GO:0030301	0.938	cholesterol transport
GO:0048518	0.927	positive regulation of biological process
GO:0006638	0.925	neutral lipid metabolic process
GO:0097006	0.924	regulation of plasma lipoprotein particle levels
GO:1905952	0.922	regulation of lipid localization
GO:0065009	0.919	regulation of molecular function
GO:0046486	0.909	glycerolipid metabolic process
GO:0051239	0.907	regulation of multicellular organismal process
GO:0044092	0.902	negative regulation of molecular function
GO:0051049	0.897	regulation of transport
GO:0006807	0.892	nitrogen compound metabolic process
GO:0050790	0.892	regulation of catalytic activity
GO:1901564	0.878	organonitrogen compound metabolic process
GO:0080090	0.878	regulation of primary metabolic process
GO:0032368	0.878	regulation of lipid transport
GO:0060255	0.874	regulation of macromolecule metabolic process
GO:0032374	0.871	regulation of cholesterol transport
GO:0060627	0.866	regulation of vesicle-mediated transport
GO:0043170	0.858	macromolecule metabolic process
GO:0048523	0.856	negative regulation of cellular process
GO:0015914	0.845	phospholipid transport
GO:0051241	0.838	negative regulation of multicellular organismal process
GO:0071840	0.836	cellular component organization or biogenesis
GO:0042221	0.836	response to chemical
GO:0009893	0.832	positive regulation of metabolic process
GO:0016043	0.830	cellular component organization
GO:0071827	0.801	plasma lipoprotein particle organization
GO:0010468	0.793	regulation of gene expression
GO:0051346	0.786	negative regulation of hydrolase activity
GO:0060191	0.776	regulation of lipase activity
GO:0006639	0.771	acylglycerol metabolic process
GO:0019538	0.762	protein metabolic process
GO:0051051	0.738	negative regulation of transport
GO:0010605	0.661	negative regulation of macromolecule metabolic process
GO:0009056	0.655	catabolic process
GO:1901575	0.645	organic substance catabolic process
GO:0065008	0.634	regulation of biological quality
GO:0010033	0.611	response to organic substance
GO:0010604	0.556	positive regulation of macromolecule metabolic process
GO:0016042	0.545	lipid catabolic process
GO:1905953	0.516	negative regulation of lipid localization
GO:0044242	0.515	cellular lipid catabolic process
GO:0051050	0.500	positive regulation of transport
GO:0048522	0.459	positive regulation of cellular process
GO:0031323	0.443	regulation of cellular metabolic process
GO:0051171	0.441	regulation of nitrogen compound metabolic process
GO:0051128	0.420	regulation of cellular component organization
GO:0019216	0.396	regulation of lipid metabolic process
GO:0001817	0.386	regulation of cytokine production
GO:0002682	0.381	regulation of immune system process
GO:0009894	0.378	regulation of catabolic process
GO:0051129	0.369	negative regulation of cellular component organization
GO:0048583	0.366	regulation of response to stimulus
GO:0051240	0.343	positive regulation of multicellular organismal process
GO:0006641	0.339	triglyceride metabolic process
GO:0009058	0.338	biosynthetic process
GO:1901576	0.328	organic substance biosynthetic process
GO:0019637	0.327	organophosphate metabolic process
GO:0032369	0.324	negative regulation of lipid transport
GO:0006650	0.322	glycerophospholipid metabolic process
GO:0046503	0.317	glycerolipid catabolic process
GO:0044093	0.310	positive regulation of molecular function
GO:0002697	0.309	regulation of immune effector process
GO:0046464	0.307	acylglycerol catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0031982	0.997	vesicle
GO:0012505	0.996	endomembrane system
GO:0032991	0.995	protein-containing complex
GO:0070062	0.988	extracellular exosome
GO:0031410	0.975	cytoplasmic vesicle
GO:0005783	0.969	endoplasmic reticulum
GO:0032994	0.952	protein-lipid complex
GO:0034358	0.925	plasma lipoprotein particle
GO:0072562	0.910	blood microparticle
GO:0005788	0.901	endoplasmic reticulum lumen
GO:0034364	0.882	high-density lipoprotein particle
GO:0034361	0.865	very-low-density lipoprotein particle
GO:0005768	0.800	endosome
GO:0005769	0.711	early endosome
GO:0016020	0.540	membrane
GO:0042627	0.461	chylomicron
GO:0034366	0.461	spherical high-density lipoprotein particle
GO:0071944	0.430	cell periphery
GO:0031981	0.386	nuclear lumen
GO:0005654	0.349	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.999	cholesterol(in) = cholesterol(out)

[back to server]