StarFunc result for job id P02654

User Input

>input (83 residues)
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSEL
SAKMREWFSETFQKVKEKLKIDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02654	1.000	1.000	1.848E-12	83	1.000	1.000	P02654.pdb.gz	APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens OX=9606 GN=APOC1 PE=1 SV=1
2	AFDB:P40753	0.282	0.197	2.586	121	0.145	0.099	P40753.pdb.gz	ANFB_MOUSE Natriuretic peptides B OS=Mus musculus OX=10090 GN=Nppb PE=1 SV=2
3	AFDB:P09690	0.223	0.050	3.906	501	0.133	0.022	P09690.pdb.gz	ACHB_MOUSE Acetylcholine receptor subunit beta OS=Mus musculus OX=10090 GN=Chrnb1 PE=2 SV=1
4	AFDB:Q02199	0.304	0.087	4.606	472	0.205	0.036	Q02199.pdb.gz	NUP49_YEAST Nucleoporin NUP49/NSP49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP49 PE=1 SV=1
5	AFDB:Q8WY22	0.311	0.144	5.900	251	0.181	0.060	Q8WY22.pdb.gz	BRI3B_HUMAN BRI3-binding protein OS=Homo sapiens OX=9606 GN=BRI3BP PE=1 SV=1
6	AFDB:A0A6G9KJK9	0.263	0.266	6.407	82	0.145	0.146	A0A6G9KJK9.pdb.gz	TX10A_MANRB U10-myrmicitoxin-Mri1a OS=Manica rubida OX=219785 PE=1 SV=1
7	AFDB:C8VEZ2	0.233	0.052	6.958	454	0.084	0.015	C8VEZ2.pdb.gz	C8VEZ2_EMENI coproporphyrinogen oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05130 PE=3 SV=1
8	AFDB:O13615	0.223	0.067	6.958	473	0.157	0.027	O13615.pdb.gz	PRP46_SCHPO Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp5 PE=1 SV=1
9	AFDB:Q24451	0.343	0.031	6.958	1108	0.253	0.019	Q24451.pdb.gz	MAN2_DROME Alpha-mannosidase 2 OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIa PE=1 SV=2
10	AFDB:Q9VET0	0.252	0.212	6.958	102	0.145	0.118	Q9VET0.pdb.gz	NPF_DROME Neuropeptide F OS=Drosophila melanogaster OX=7227 GN=NPF PE=1 SV=1
11	PDB:6kytC	0.243	0.270	8.368	73	0.108	0.123	6kytC.pdb.gz
12	PDB:6ks6E	0.224	0.044	9.088	536	0.108	0.017	6ks6E.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02654	3.69e-54	164	83	1.000	1.000	APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens OX=9606 GN=APOC1 PE=1 SV=1
2	P19939	2.22e-34	114	88	0.675	0.636	APOC1_RAT Apolipoprotein C-I OS=Rattus norvegicus OX=10116 GN=Apoc1 PE=3 SV=1
3	P34928	8.47e-34	113	88	0.675	0.636	APOC1_MOUSE Apolipoprotein C-I OS=Mus musculus OX=10090 GN=Apoc1 PE=1 SV=1
4	E9QDI1	8.88e-11	54.7	85	0.349	0.341	E9QDI1_DANRE Apolipoprotein C-I OS=Danio rerio OX=7955 GN=apoc1l PE=1 SV=1
5	E9QFX0	2.46e-10	53.5	84	0.349	0.345	E9QFX0_DANRE Apolipoprotein C-I OS=Danio rerio OX=7955 GN=apoc1l PE=1 SV=1
6	K4GIP0	0.096	32.3	495	0.193	0.032	73C12_BARVU UDP-glycosyltransferase 73C12 OS=Barbarea vulgaris OX=50459 GN=UGT73C12 PE=1 SV=1
7	K4GHS2	0.27	31.2	495	0.193	0.032	73C13_BARVU UDP-glycosyltransferase 73C13 OS=Barbarea vulgaris OX=50459 GN=UGT73C13 PE=1 SV=1
8	K4GKX2	0.35	30.8	495	0.193	0.032	73C10_BARVU UDP-glycosyltransferase 73C10 OS=Barbarea vulgaris OX=50459 GN=UGT73C10 PE=1 SV=1
9	K4GGT4	0.39	30.8	495	0.193	0.032	73C11_BARVU UDP-glycosyltransferase 73C11 OS=Barbarea vulgaris OX=50459 GN=UGT73C11 PE=1 SV=1
10	Q6DRP8	0.50	30.4	859	0.229	0.022	Q6DRP8_DANRE Nop14-like OS=Danio rerio OX=7955 GN=cb168 PE=1 SV=1
11	Q9ZQ94	0.69	30.0	495	0.193	0.032	U73C5_ARATH UDP-glycosyltransferase 73C5 OS=Arabidopsis thaliana OX=3702 GN=UGT73C5 PE=2 SV=1
12	A0A2R4LMF9	0.83	30.0	495	0.181	0.030	73C25_BARVU UDP-glycosyltransferase 73C25 OS=Barbarea vulgaris OX=50459 GN=UGT73C25 PE=2 SV=1
13	K4GHR9	1.1	29.6	495	0.181	0.030	UGT1_BARVU UDP-glycosyltransferase 1 OS=Barbarea vulgaris OX=50459 GN=UGT1 PE=1 SV=1
14	Q8I4T3	1.5	29.3	3119	0.193	0.005	Q8I4T3_PLAF7 Osmiophilic body protein G377 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1250100 PE=4 SV=1
15	Q810P3	1.7	28.9	211	0.133	0.052	CDKN3_MOUSE Cyclin-dependent kinase inhibitor 3 OS=Mus musculus OX=10090 GN=Cdkn3 PE=2 SV=1
16	Q9ZQ99	1.9	28.9	491	0.217	0.037	U73C1_ARATH UDP-glycosyltransferase 73C1 OS=Arabidopsis thaliana OX=3702 GN=UGT73C1 PE=2 SV=1
17	C6KT15	2.2	28.9	2394	0.145	0.005	C6KT15_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0617400 PE=4 SV=1
18	F7EXG8	2.3	28.5	412	0.169	0.034	F7EXG8_RAT Nuclear envelope integral membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Nemp1 PE=1 SV=1
19	Q6ZQE4	3.1	28.1	437	0.193	0.037	NEMP1_MOUSE Nuclear envelope integral membrane protein 1 OS=Mus musculus OX=10090 GN=Nemp1 PE=1 SV=2
20	M3TYT0	3.8	28.1	1388	0.181	0.011	ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa OX=9823 GN=ROCK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05778 Apo-CIII	16	16.5	Apolipoprotein CIII (Apo-CIII)
2	PF04711 ApoA-II	1e+02	14.7	Apolipoprotein A-II (ApoA-II)
3	PF04691 ApoC-I	2e-24	96.5	Apolipoprotein C-I (ApoC-1)
4	PF19802 DUF6285	3.8e+02	13.3	Domain of unknown function (DUF6285)
5	PF12732 YtxH	2.4e+02	13.7	YtxH-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252486	0.995	Apolipoprotein E
2	9606.ENSP00000236850	0.972	Apolipoprotein A-I
3	9606.ENSP00000227667	0.969	Apolipoprotein C-III
4	9606.ENSP00000466775	0.965	Apolipoprotein C-II
5	9606.ENSP00000468236	0.955	Apolipoprotein C-IV
6	9606.ENSP00000356969	0.954	Apolipoprotein A-II
7	9606.ENSP00000252490	0.938	Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL
8	9606.ENSP00000200676	0.934	Cholesteryl ester transfer protein
9	9606.ENSP00000233242	0.928	Apolipoprotein B-100
10	9606.ENSP00000477707	0.927	Oxysterols receptor LXR-alpha
11	9606.ENSP00000253727	0.918	Oxysterols receptor LXR-beta
12	9606.ENSP00000264005	0.912	Phosphatidylcholine-sterol acyltransferase
13	9606.ENSP00000445002	0.912	Apolipoprotein A-V
14	9606.ENSP00000321334	0.908	Apolipoprotein(a)
15	9606.ENSP00000419692	0.906	Retinoic acid receptor RXR-alpha
16	9606.ENSP00000350425	0.904	Apolipoprotein A-IV
17	9606.ENSP00000363817	0.903	Retinoic acid receptor RXR-beta
18	9606.ENSP00000365081	0.899	Apolipoprotein M
19	9606.ENSP00000222381	0.892	Serum paraoxonase/arylesterase 1
20	9606.ENSP00000205948	0.891	Beta-2-glycoprotein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004857	1.000	enzyme inhibitor activity
GO:0005504	1.000	fatty acid binding
GO:0008047	0.999	enzyme activator activity
GO:0031210	0.997	phosphatidylcholine binding
GO:0055102	0.790	lipase inhibitor activity
GO:0042802	0.762	identical protein binding
GO:0060228	0.711	phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0004859	0.705	phospholipase inhibitor activity
GO:0005102	0.569	signaling receptor binding
GO:0097159	0.510	organic cyclic compound binding
GO:0005215	0.375	transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.986	biological regulation
GO:0071704	0.983	organic substance metabolic process
GO:0050789	0.983	regulation of biological process
GO:0044238	0.983	primary metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0006869	0.967	lipid transport
GO:0097006	0.960	regulation of plasma lipoprotein particle levels
GO:0071825	0.959	protein-lipid complex subunit organization
GO:0030301	0.956	cholesterol transport
GO:0060627	0.953	regulation of vesicle-mediated transport
GO:1905952	0.949	regulation of lipid localization
GO:0009892	0.948	negative regulation of metabolic process
GO:0019216	0.946	regulation of lipid metabolic process
GO:0031323	0.942	regulation of cellular metabolic process
GO:0032501	0.932	multicellular organismal process
GO:0065009	0.925	regulation of molecular function
GO:0050790	0.921	regulation of catalytic activity
GO:0048523	0.920	negative regulation of cellular process
GO:0062012	0.913	regulation of small molecule metabolic process
GO:0051128	0.909	regulation of cellular component organization
GO:0032371	0.899	regulation of sterol transport
GO:0015748	0.896	organophosphate ester transport
GO:0009889	0.895	regulation of biosynthetic process
GO:0015914	0.893	phospholipid transport
GO:0030100	0.892	regulation of endocytosis
GO:0051051	0.889	negative regulation of transport
GO:0009894	0.885	regulation of catabolic process
GO:0071827	0.882	plasma lipoprotein particle organization
GO:0006629	0.876	lipid metabolic process
GO:0051129	0.875	negative regulation of cellular component organization
GO:1905953	0.862	negative regulation of lipid localization
GO:0045833	0.854	negative regulation of lipid metabolic process
GO:0046890	0.842	regulation of lipid biosynthetic process
GO:0048259	0.817	regulation of receptor-mediated endocytosis
GO:0051239	0.794	regulation of multicellular organismal process
GO:0051336	0.780	regulation of hydrolase activity
GO:0051055	0.770	negative regulation of lipid biosynthetic process
GO:0060191	0.740	regulation of lipase activity
GO:0032374	0.730	regulation of cholesterol transport
GO:0062014	0.696	negative regulation of small molecule metabolic process
GO:0031326	0.688	regulation of cellular biosynthetic process
GO:0019217	0.653	regulation of fatty acid metabolic process
GO:0048518	0.627	positive regulation of biological process
GO:0051241	0.624	negative regulation of multicellular organismal process
GO:0051171	0.594	regulation of nitrogen compound metabolic process
GO:0045806	0.582	negative regulation of endocytosis
GO:0044237	0.574	cellular metabolic process
GO:0048261	0.550	negative regulation of receptor-mediated endocytosis
GO:0006807	0.527	nitrogen compound metabolic process
GO:0032369	0.491	negative regulation of lipid transport
GO:0031329	0.475	regulation of cellular catabolic process
GO:0042304	0.469	regulation of fatty acid biosynthetic process
GO:0031324	0.466	negative regulation of cellular metabolic process
GO:0050994	0.464	regulation of lipid catabolic process
GO:0043086	0.451	negative regulation of catalytic activity
GO:1901564	0.434	organonitrogen compound metabolic process
GO:0060255	0.389	regulation of macromolecule metabolic process
GO:0065003	0.387	protein-containing complex assembly
GO:0009895	0.386	negative regulation of catabolic process
GO:0042592	0.370	homeostatic process
GO:0055088	0.362	lipid homeostasis
GO:0019220	0.362	regulation of phosphate metabolic process
GO:0031330	0.357	negative regulation of cellular catabolic process
GO:0045922	0.357	negative regulation of fatty acid metabolic process
GO:0051346	0.354	negative regulation of hydrolase activity
GO:0042632	0.345	cholesterol homeostasis
GO:0050896	0.338	response to stimulus
GO:0048522	0.335	positive regulation of cellular process
GO:1903725	0.319	regulation of phospholipid metabolic process
GO:0043170	0.317	macromolecule metabolic process
GO:0051172	0.302	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0034364	0.999	high-density lipoprotein particle
GO:0012505	0.998	endomembrane system
GO:0034361	0.997	very-low-density lipoprotein particle
GO:0005783	0.950	endoplasmic reticulum
GO:0031982	0.768	vesicle
GO:0042627	0.508	chylomicron
GO:0005829	0.481	cytosol
GO:0070013	0.430	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]