StarFunc result for job id P02655

User Input

>input (101 residues)
MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02655	1.000	1.000	8.486E-16	101	1.000	1.000	P02655.pdb.gz	APOC2_HUMAN Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1
2	PDB:1o8tA	0.354	0.425	9.089E-9	79	0.772	0.987	1o8tA.pdb.gz
3	AFDB:A0A286YAE3	0.553	0.505	5.818E-2	114	0.287	0.254	A0A286YAE3.pdb.gz
4	AFDB:Q9VU58	0.308	0.344	4.484E-1	86	0.178	0.209	Q9VU58.pdb.gz	NPLP2_DROME Neuropeptide-like 2 OS=Drosophila melanogaster OX=7227 GN=Nplp2 PE=1 SV=1
5	PDB:5lj5O	0.236	0.111	1.975	283	0.099	0.035	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
6	AFDB:P84480	0.254	0.104	2.117	290	0.129	0.045	P84480.pdb.gz	MREC_GEOSE Cell shape-determining protein MreC OS=Geobacillus stearothermophilus OX=1422 GN=mreC PE=3 SV=1
7	AFDB:Q8IEU1	0.306	0.141	2.117	229	0.109	0.048	Q8IEU1.pdb.gz	Q8IEU1_PLAF7 Early transcribed membrane protein 13 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1302200 PE=1 SV=1
8	PDB:6m4gC	0.254	0.277	4.120	90	0.109	0.122	6m4gC.pdb.gz	Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
9	AFDB:Q6GV01	0.313	0.169	4.792	223	0.119	0.054	Q6GV01.pdb.gz	Q6GV01_DROME Lectin30A (Fragment) OS=Drosophila melanogaster OX=7227 GN=lectin-30A PE=4 SV=1
10	PDB:7ungR	0.197	0.108	4.851	219	0.168	0.078	7ungR.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
11	AFDB:E9QDI1	0.356	0.401	5.200	85	0.208	0.247	E9QDI1.pdb.gz	E9QDI1_DANRE Apolipoprotein C-I OS=Danio rerio OX=7955 GN=apoc1l PE=1 SV=1
12	AFDB:Q9Y2W1	0.238	0.035	5.200	955	0.119	0.013	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
13	PDB:7d4iA9	0.199	0.172	5.264	128	0.079	0.062	7d4iA9.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
14	AFDB:Q8I632	0.242	0.232	6.123	106	0.168	0.160	Q8I632.pdb.gz	Q8I632_PLAF7 Liver stage associated protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1201300 PE=4 SV=1
15	AFDB:F1T150	0.292	0.338	6.644	84	0.119	0.143	F1T150.pdb.gz	ES1IB_ODOIS Esculentin-1ISb OS=Odorrana ishikawae OX=310659 PE=1 SV=1
16	PDB:1id3C	0.167	0.158	7.920	110	0.069	0.064	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02655	2.23e-69	204	101	1.000	1.000	APOC2_HUMAN Apolipoprotein C-II OS=Homo sapiens OX=9606 GN=APOC2 PE=1 SV=1
2	Q05020	2.33e-35	118	97	0.594	0.619	APOC2_MOUSE Apolipoprotein C-II OS=Mus musculus OX=10090 GN=Apoc2 PE=2 SV=1
3	G3V8D4	3.74e-31	107	97	0.634	0.660	APOC2_RAT Apolipoprotein C-II OS=Rattus norvegicus OX=10116 GN=Apoc2 PE=3 SV=1
4	E9QEQ1	2.75e-06	44.3	100	0.297	0.300	E9QEQ1_DANRE Apolipoprotein C-II OS=Danio rerio OX=7955 GN=fb71a04 PE=1 SV=1
5	Q8ZNR3	0.78	30.8	782	0.139	0.018	SOPA_SALTY E3 ubiquitin-protein ligase SopA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=sopA PE=1 SV=1
6	Q9S4P4	0.88	30.4	782	0.129	0.017	SOPA_SALDU E3 ubiquitin-protein ligase SopA OS=Salmonella dublin OX=98360 GN=sopA PE=1 SV=1
7	Q9NG24	0.92	30.4	1476	0.168	0.012	Q9NG24_DROME Chromatin accessibility complex (CHRAC) OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
8	Q9Y0W1	0.96	30.4	1476	0.168	0.012	Q9Y0W1_DROME ATP-dependent chromatin assembly factor large subunit OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
9	Q9V9T4	0.98	30.4	1476	0.168	0.012	Q9V9T4_DROME ATP-dependent chromatin assembly factor large subunit OS=Drosophila melanogaster OX=7227 GN=Acf PE=1 SV=1
10	Q5BI37	1.3	30.0	1151	0.168	0.015	Q5BI37_DROME LD32807p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
11	G3XCY2	6.7	27.7	348	0.168	0.049	G3XCY2_PSEAE O-antigen chain length regulator OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wzz PE=4 SV=1
12	Q7B786	6.7	27.7	348	0.168	0.049	Q7B786_PSEAI O-antigen chain length regulator OS=Pseudomonas aeruginosa OX=287 GN=DT376_20125 PE=4 SV=1
13	Q9H825	7.4	27.7	291	0.139	0.048	METL8_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL8, mitochondrial OS=Homo sapiens OX=9606 GN=METTL8 PE=1 SV=2
14	P97706	7.8	27.7	1702	0.188	0.011	P97706_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=2 SV=1
15	F4K8F7	8.9	27.7	470	0.208	0.045	F4K8F7_ARATH GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PNT1 PE=1 SV=1
16	M9MRX4	9.7	27.7	13559	0.139	0.001	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05355 Apo-CII	2.8e-38	141.2	Apolipoprotein C-II

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000466775

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309757	0.998	Lipoprotein lipase
2	9606.ENSP00000236850	0.992	Apolipoprotein A-I
3	9606.ENSP00000252486	0.989	Apolipoprotein E
4	9606.ENSP00000227667	0.986	Apolipoprotein C-III
5	9606.ENSP00000480053	0.985	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
6	9606.ENSP00000445002	0.983	Apolipoprotein A-V
7	9606.ENSP00000356969	0.981	Apolipoprotein A-II
8	9606.ENSP00000233242	0.980	Apolipoprotein B-100
9	9606.ENSP00000465356	0.965	Apolipoprotein C-I
10	9606.ENSP00000350425	0.953	Apolipoprotein A-IV
11	9606.ENSP00000078445	0.950	Cyclic AMP-responsive element-binding protein 3-like protein 3
12	9606.ENSP00000365081	0.950	Apolipoprotein M
13	9606.ENSP00000468236	0.946	Apolipoprotein C-IV
14	9606.ENSP00000454071	0.944	Low-density lipoprotein receptor
15	9606.ENSP00000321334	0.934	Apolipoprotein(a)
16	9606.ENSP00000471477	0.924	Fibroblast growth factor 21
17	9606.ENSP00000243077	0.923	Prolow-density lipoprotein receptor-related protein 1
18	9606.ENSP00000477707	0.922	Oxysterols receptor LXR-alpha
19	9606.ENSP00000373328	0.921	Cell death activator CIDE-3
20	9606.ENSP00000253727	0.915	Oxysterols receptor LXR-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	0.999	lipid binding
GO:0043274	0.999	phospholipase binding
GO:0004857	0.999	enzyme inhibitor activity
GO:0016004	0.999	phospholipase activator activity
GO:0042802	0.998	identical protein binding
GO:0055102	0.955	lipase inhibitor activity
GO:0060230	0.947	lipoprotein lipase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0033036	0.990	macromolecule localization
GO:0071702	0.990	organic substance transport
GO:0065007	0.985	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0097006	0.980	regulation of plasma lipoprotein particle levels
GO:0055092	0.979	sterol homeostasis
GO:0048518	0.977	positive regulation of biological process
GO:0071825	0.977	protein-lipid complex subunit organization
GO:1905952	0.976	regulation of lipid localization
GO:0042632	0.974	cholesterol homeostasis
GO:0032501	0.970	multicellular organismal process
GO:0015850	0.968	organic hydroxy compound transport
GO:0019222	0.967	regulation of metabolic process
GO:0080090	0.962	regulation of primary metabolic process
GO:0030301	0.962	cholesterol transport
GO:0048519	0.961	negative regulation of biological process
GO:0071827	0.956	plasma lipoprotein particle organization
GO:0048523	0.953	negative regulation of cellular process
GO:0051128	0.950	regulation of cellular component organization
GO:0019216	0.947	regulation of lipid metabolic process
GO:0062012	0.944	regulation of small molecule metabolic process
GO:0048522	0.944	positive regulation of cellular process
GO:0009893	0.944	positive regulation of metabolic process
GO:0031323	0.940	regulation of cellular metabolic process
GO:0051049	0.934	regulation of transport
GO:0015748	0.932	organophosphate ester transport
GO:0009889	0.924	regulation of biosynthetic process
GO:0032368	0.916	regulation of lipid transport
GO:0032371	0.914	regulation of sterol transport
GO:0060627	0.905	regulation of vesicle-mediated transport
GO:0046890	0.904	regulation of lipid biosynthetic process
GO:0015914	0.899	phospholipid transport
GO:0032374	0.897	regulation of cholesterol transport
GO:0051239	0.894	regulation of multicellular organismal process
GO:0060191	0.884	regulation of lipase activity
GO:0030100	0.882	regulation of endocytosis
GO:0051129	0.876	negative regulation of cellular component organization
GO:0045834	0.872	positive regulation of lipid metabolic process
GO:0071704	0.871	organic substance metabolic process
GO:0031326	0.868	regulation of cellular biosynthetic process
GO:0051051	0.860	negative regulation of transport
GO:0050896	0.858	response to stimulus
GO:0010565	0.839	regulation of cellular ketone metabolic process
GO:0019217	0.833	regulation of fatty acid metabolic process
GO:0044238	0.800	primary metabolic process
GO:0009892	0.798	negative regulation of metabolic process
GO:0031325	0.776	positive regulation of cellular metabolic process
GO:0009894	0.746	regulation of catabolic process
GO:0062013	0.741	positive regulation of small molecule metabolic process
GO:0051241	0.735	negative regulation of multicellular organismal process
GO:0046889	0.702	positive regulation of lipid biosynthetic process
GO:0051641	0.697	cellular localization
GO:0045806	0.690	negative regulation of endocytosis
GO:0055090	0.686	acylglycerol homeostasis
GO:0044093	0.651	positive regulation of molecular function
GO:0045923	0.633	positive regulation of fatty acid metabolic process
GO:0042304	0.617	regulation of fatty acid biosynthetic process
GO:0048259	0.609	regulation of receptor-mediated endocytosis
GO:0043085	0.561	positive regulation of catalytic activity
GO:0006629	0.514	lipid metabolic process
GO:0070328	0.511	triglyceride homeostasis
GO:0019220	0.499	regulation of phosphate metabolic process
GO:0031328	0.498	positive regulation of cellular biosynthetic process
GO:1905953	0.495	negative regulation of lipid localization
GO:0050994	0.458	regulation of lipid catabolic process
GO:1903725	0.456	regulation of phospholipid metabolic process
GO:0044237	0.439	cellular metabolic process
GO:0032369	0.427	negative regulation of lipid transport
GO:0051345	0.423	positive regulation of hydrolase activity
GO:0009896	0.408	positive regulation of catabolic process
GO:0042221	0.403	response to chemical
GO:0045833	0.389	negative regulation of lipid metabolic process
GO:0051240	0.386	positive regulation of multicellular organismal process
GO:0090207	0.362	regulation of triglyceride metabolic process
GO:0031329	0.351	regulation of cellular catabolic process
GO:0051716	0.335	cellular response to stimulus
GO:0051130	0.324	positive regulation of cellular component organization
GO:0060193	0.320	positive regulation of lipase activity
GO:0048261	0.319	negative regulation of receptor-mediated endocytosis
GO:0051004	0.314	regulation of lipoprotein lipase activity
GO:0050996	0.314	positive regulation of lipid catabolic process
GO:0090208	0.314	positive regulation of triglyceride metabolic process
GO:0045723	0.314	positive regulation of fatty acid biosynthetic process
GO:0033700	0.308	phospholipid efflux
GO:0060255	0.300	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0031982	0.996	vesicle
GO:0034358	0.995	plasma lipoprotein particle
GO:0031410	0.992	cytoplasmic vesicle
GO:0034361	0.981	very-low-density lipoprotein particle
GO:0034364	0.979	high-density lipoprotein particle
GO:0005768	0.937	endosome
GO:0005769	0.891	early endosome
GO:0016020	0.707	membrane
GO:0034362	0.679	low-density lipoprotein particle
GO:0034363	0.679	intermediate-density lipoprotein particle
GO:0034366	0.667	spherical high-density lipoprotein particle
GO:0042627	0.665	chylomicron
GO:0005829	0.540	cytosol
GO:0070013	0.347	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]