StarFunc result for job id P02656

User Input

>input (99 residues)
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02656	1.000	1.000	8.725E-15	99	1.000	1.000	P02656.pdb.gz	APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens OX=9606 GN=APOC3 PE=1 SV=1
2	AFDB:P33622	0.452	0.452	2.612E-8	99	0.606	0.606	P33622.pdb.gz	APOC3_MOUSE Apolipoprotein C-III OS=Mus musculus OX=10090 GN=Apoc3 PE=1 SV=2
3	AFDB:Q8TAP8	0.189	0.103	7.444	253	0.071	0.028	Q8TAP8.pdb.gz	PPR35_HUMAN Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02656	3.79e-67	198	99	1.000	1.000	APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens OX=9606 GN=APOC3 PE=1 SV=1
2	P33622	1.30e-25	93.6	99	0.606	0.606	APOC3_MOUSE Apolipoprotein C-III OS=Mus musculus OX=10090 GN=Apoc3 PE=1 SV=2
3	P06759	1.19e-23	88.6	101	0.556	0.545	APOC3_RAT Apolipoprotein C-III OS=Rattus norvegicus OX=10116 GN=Apoc3 PE=2 SV=2
4	H2FLL1	0.086	33.5	1397	0.212	0.015	H2FLL1_CAEEL Plant Late Embryo Abundant (LEA) related OS=Caenorhabditis elegans OX=6239 GN=lea-1 PE=1 SV=1
5	P04638	0.14	31.6	102	0.212	0.206	APOA2_RAT Apolipoprotein A-II OS=Rattus norvegicus OX=10116 GN=Apoa2 PE=2 SV=1
6	A2AL36	1.4	30.0	2334	0.152	0.006	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
7	Q5I0P2	1.9	29.3	170	0.232	0.135	GCSH_RAT Glycine cleavage system H protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gcsh PE=2 SV=1
8	Q9VB14	5.2	27.7	163	0.162	0.098	RS10A_DROME Small ribosomal subunit protein eS10A OS=Drosophila melanogaster OX=7227 GN=RpS10a PE=1 SV=1
9	Q9XU42	5.5	28.1	735	0.111	0.015	GCY27_CAEEL Receptor-type guanylate cyclase gcy-27 OS=Caenorhabditis elegans OX=6239 GN=gcy-27 PE=2 SV=4
10	Q9DF53	6.0	28.1	1949	0.121	0.006	Q9DF53_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn8a PE=2 SV=1
11	A0A0H3JRU9	7.1	27.7	1150	0.101	0.009	PYC_STAAM Pyruvate carboxylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=pycA PE=1 SV=1
12	A0A590UK43	8.5	27.7	1939	0.121	0.006	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
13	C9JZA9	8.5	27.3	316	0.121	0.038	C9JZA9_HUMAN FA complementation group L OS=Homo sapiens OX=9606 GN=FANCL PE=1 SV=2
14	O88420	8.5	27.7	1978	0.121	0.006	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1
15	Q9UQD0	8.5	27.7	1980	0.121	0.006	SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
16	Q9WTU3	8.5	27.7	1978	0.121	0.006	SCN8A_MOUSE Sodium channel protein type 8 subunit alpha OS=Mus musculus OX=10090 GN=Scn8a PE=1 SV=1
17	Q9NW38	8.8	27.3	375	0.121	0.032	FANCL_HUMAN E3 ubiquitin-protein ligase FANCL OS=Homo sapiens OX=9606 GN=FANCL PE=1 SV=2
18	H7C1M0	9.4	27.3	390	0.121	0.031	H7C1M0_HUMAN FA complementation group L OS=Homo sapiens OX=9606 GN=FANCL PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05778 Apo-CIII	2.1e-35	131.4	Apolipoprotein CIII (Apo-CIII)
2	PF04711 ApoA-II	7.8	18.3	Apolipoprotein A-II (ApoA-II)
3	PF04691 ApoC-I	3.4	18.9	Apolipoprotein C-I (ApoC-1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000227667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000236850	0.999	Apolipoprotein A-I
2	9606.ENSP00000233242	0.996	Apolipoprotein B-100
3	9606.ENSP00000356969	0.994	Apolipoprotein A-II
4	9606.ENSP00000445002	0.993	Apolipoprotein A-V
5	9606.ENSP00000309757	0.988	Lipoprotein lipase
6	9606.ENSP00000466775	0.986	Apolipoprotein C-II
7	9606.ENSP00000350425	0.984	Apolipoprotein A-IV
8	9606.ENSP00000205948	0.980	Beta-2-glycoprotein 1
9	9606.ENSP00000252486	0.971	Apolipoprotein E
10	9606.ENSP00000465356	0.969	Apolipoprotein C-I
11	9606.ENSP00000480053	0.967	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
12	9606.ENSP00000321334	0.956	Apolipoprotein(a)
13	9606.ENSP00000454071	0.953	Low-density lipoprotein receptor
14	9606.ENSP00000200676	0.943	Cholesteryl ester transfer protein
15	9606.ENSP00000243077	0.921	Prolow-density lipoprotein receptor-related protein 1
16	9606.ENSP00000468236	0.921	Apolipoprotein C-IV
17	9606.ENSP00000303634	0.912	Low-density lipoprotein receptor-related protein 8
18	9606.ENSP00000252490	0.911	Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidemic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridemic individuals, predominantly found in the VLDL and LDL
19	9606.ENSP00000365081	0.908	Apolipoprotein M
20	9606.ENSP00000222381	0.907	Serum paraoxonase/arylesterase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070325	0.999	lipoprotein particle receptor binding
GO:0004857	0.999	enzyme inhibitor activity
GO:0015485	0.999	cholesterol binding
GO:0005543	0.997	phospholipid binding
GO:0055102	0.873	lipase inhibitor activity
GO:0070653	0.871	high-density lipoprotein particle receptor binding
GO:0042802	0.458	identical protein binding
GO:0043167	0.426	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0050794	0.976	regulation of cellular process
GO:0006869	0.971	lipid transport
GO:0044237	0.962	cellular metabolic process
GO:0050896	0.954	response to stimulus
GO:0048583	0.954	regulation of response to stimulus
GO:0048878	0.935	chemical homeostasis
GO:0051239	0.935	regulation of multicellular organismal process
GO:0046503	0.918	glycerolipid catabolic process
GO:0032501	0.913	multicellular organismal process
GO:0046464	0.912	acylglycerol catabolic process
GO:0045833	0.905	negative regulation of lipid metabolic process
GO:0030301	0.904	cholesterol transport
GO:0032374	0.900	regulation of cholesterol transport
GO:0071827	0.894	plasma lipoprotein particle organization
GO:0048523	0.885	negative regulation of cellular process
GO:0042632	0.875	cholesterol homeostasis
GO:0055090	0.874	acylglycerol homeostasis
GO:0031323	0.855	regulation of cellular metabolic process
GO:0060191	0.840	regulation of lipase activity
GO:0060627	0.825	regulation of vesicle-mediated transport
GO:0009889	0.815	regulation of biosynthetic process
GO:0051716	0.797	cellular response to stimulus
GO:0006641	0.786	triglyceride metabolic process
GO:0050994	0.749	regulation of lipid catabolic process
GO:1905953	0.747	negative regulation of lipid localization
GO:0015748	0.745	organophosphate ester transport
GO:0046890	0.735	regulation of lipid biosynthetic process
GO:0097006	0.734	regulation of plasma lipoprotein particle levels
GO:0031324	0.734	negative regulation of cellular metabolic process
GO:0015914	0.732	phospholipid transport
GO:0032369	0.725	negative regulation of lipid transport
GO:0031326	0.721	regulation of cellular biosynthetic process
GO:0051128	0.718	regulation of cellular component organization
GO:0062012	0.715	regulation of small molecule metabolic process
GO:0019217	0.708	regulation of fatty acid metabolic process
GO:0030100	0.707	regulation of endocytosis
GO:0048259	0.701	regulation of receptor-mediated endocytosis
GO:0045806	0.698	negative regulation of endocytosis
GO:0070328	0.697	triglyceride homeostasis
GO:0043086	0.697	negative regulation of catalytic activity
GO:0051346	0.673	negative regulation of hydrolase activity
GO:0062014	0.666	negative regulation of small molecule metabolic process
GO:0042304	0.650	regulation of fatty acid biosynthetic process
GO:0009966	0.646	regulation of signal transduction
GO:0048261	0.623	negative regulation of receptor-mediated endocytosis
GO:0051241	0.614	negative regulation of multicellular organismal process
GO:0045922	0.571	negative regulation of fatty acid metabolic process
GO:0048518	0.566	positive regulation of biological process
GO:0006807	0.521	nitrogen compound metabolic process
GO:1902531	0.501	regulation of intracellular signal transduction
GO:0048522	0.446	positive regulation of cellular process
GO:0090207	0.388	regulation of triglyceride metabolic process
GO:0060255	0.373	regulation of macromolecule metabolic process
GO:0007154	0.350	cell communication
GO:0009890	0.339	negative regulation of biosynthetic process
GO:0023052	0.326	signaling
GO:1901564	0.317	organonitrogen compound metabolic process
GO:0009895	0.312	negative regulation of catabolic process
GO:0051055	0.305	negative regulation of lipid biosynthetic process
GO:0007165	0.302	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0012505	0.997	endomembrane system
GO:0071944	0.990	cell periphery
GO:0031982	0.990	vesicle
GO:0032994	0.970	protein-lipid complex
GO:1990777	0.956	lipoprotein particle
GO:0034358	0.942	plasma lipoprotein particle
GO:0070062	0.929	extracellular exosome
GO:0031410	0.906	cytoplasmic vesicle
GO:0034364	0.904	high-density lipoprotein particle
GO:0034361	0.888	very-low-density lipoprotein particle
GO:0016020	0.769	membrane
GO:0005768	0.746	endosome
GO:0030312	0.679	external encapsulating structure
GO:0062023	0.665	collagen-containing extracellular matrix
GO:0070013	0.661	intracellular organelle lumen
GO:0005829	0.630	cytosol
GO:0005769	0.580	early endosome
GO:0042627	0.493	chylomicron
GO:0034366	0.433	spherical high-density lipoprotein particle
GO:0034363	0.381	intermediate-density lipoprotein particle
GO:0005783	0.370	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]