StarFunc result for job id P02671

User Input

>input (866 residues)
MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA
NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC
RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ
LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW
NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV
SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK
EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF
VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS
VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR
GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH
NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG
VVWVSFRGADYSLRAVRMKIRPLVTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02671	1.000	1.000	0.000	866	1.000	1.000	P02671.pdb.gz	FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2
2	AFDB:E9PV24	0.296	0.324	1.139E-92	789	0.669	0.734	E9PV24.pdb.gz	FIBA_MOUSE Fibrinogen alpha chain OS=Mus musculus OX=10090 GN=Fga PE=1 SV=1
3	AFDB:P06399	0.349	0.374	1.259E-91	782	0.670	0.742	P06399.pdb.gz	FIBA_RAT Fibrinogen alpha chain OS=Rattus norvegicus OX=10116 GN=Fga PE=1 SV=3
4	PDB:1m1jB	0.263	0.560	2.524E-26	402	0.121	0.261	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
5	PDB:1ei3C	0.264	0.565	6.449E-25	397	0.118	0.257	1ei3C.pdb.gz
6	PDB:3ghgB	0.260	0.556	2.085E-24	401	0.119	0.257	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
7	PDB:3ghgI	0.262	0.566	2.085E-24	394	0.118	0.259	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
8	PDB:1jc9A	0.237	0.898	1.178E-23	220	0.104	0.409	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
9	PDB:4wmqA	0.169	0.389	3.226E-4	283	0.046	0.141	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
10	AFDB:F1LP90	0.088	0.071	6.646E-4	1336	0.141	0.091	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
11	PDB:5zc0A	0.141	0.327	7.052E-4	281	0.054	0.167	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
12	AFDB:A0A0R4IEP9	0.111	0.079	9.293E-4	1332	0.121	0.079	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
13	AFDB:Q9JM52	0.113	0.082	1.099E-3	1308	0.145	0.096	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
14	AFDB:O95819	0.100	0.078	1.229E-3	1239	0.129	0.090	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
15	AFDB:F1M754	0.109	0.085	2.541E-3	1178	0.118	0.087	F1M754.pdb.gz	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
16	AFDB:P83510	0.125	0.085	2.541E-3	1323	0.155	0.101	P83510.pdb.gz	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2
17	AFDB:Q57Y35	0.092	0.123	2.008E-2	623	0.114	0.159	Q57Y35.pdb.gz	Q57Y35_TRYB2 Nucleoporin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.150 PE=4 SV=1
18	PDB:4dchA	0.035	0.060	8.514E-1	434	0.010	0.021	4dchA.pdb.gz	Insights into Mechanism of Glucokinase Activation: OBSERVATION OF MULTIPLE DISTINCT PROTEIN CONFORMATIONS.
19	PDB:6dxwA	0.041	0.084	1.065	328	0.010	0.027	6dxwA.pdb.gz
20	PDB:7pdzE	0.040	0.100	1.065	272	0.021	0.066	7pdzE.pdb.gz	A barbed end interference mechanism reveals how capping protein promotes nucleation in branched actin networks.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3E8	0.0	850	436	0.478	0.950	A0A0S2Z3E8_HUMAN Fibrinogen alpha chain isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=1
2	E9PV24	0.0	1113	789	0.674	0.740	FIBA_MOUSE Fibrinogen alpha chain OS=Mus musculus OX=10090 GN=Fga PE=1 SV=1
3	P02671	0.0	1790	866	1.000	1.000	FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2
4	P06399	0.0	1082	782	0.669	0.740	FIBA_RAT Fibrinogen alpha chain OS=Rattus norvegicus OX=10116 GN=Fga PE=1 SV=3
5	P14448	4.45e-145	448	741	0.291	0.340	FIBA_CHICK Fibrinogen alpha chain OS=Gallus gallus OX=9031 GN=FGA PE=1 SV=4
6	B8A5L6	1.66e-105	342	684	0.173	0.219	B8A5L6_DANRE Fibrinogen alpha chain OS=Danio rerio OX=7955 GN=sb:cb892 PE=1 SV=1
7	Q8WW76	2.24e-101	315	218	0.174	0.693	Q8WW76_HUMAN FGA protein OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=1
8	P02676	1.55e-57	206	468	0.136	0.252	FIBB_BOVIN Fibrinogen beta chain OS=Bos taurus OX=9913 GN=FGB PE=1 SV=2
9	Q6NYE1	1.66e-57	207	485	0.124	0.221	Q6NYE1_DANRE Fibrinogen beta chain OS=Danio rerio OX=7955 GN=wu:fa55c11 PE=1 SV=1
10	Q5KQT9	3.48e-56	204	510	0.127	0.216	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1
11	B0UXH5	4.56e-56	204	519	0.127	0.212	B0UXH5_DANRE Angiopoietin-like 2b OS=Danio rerio OX=7955 GN=angptl2 PE=4 SV=1
12	P14480	7.45e-56	202	479	0.134	0.242	FIBB_RAT Fibrinogen beta chain OS=Rattus norvegicus OX=10116 GN=Fgb PE=1 SV=4
13	D6REL8	3.02e-55	194	272	0.125	0.397	D6REL8_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=1
14	Q08830	5.04e-55	194	312	0.126	0.349	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3
15	Q8K0E8	1.30e-54	199	481	0.132	0.237	FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus OX=10090 GN=Fgb PE=1 SV=1
16	P02679	1.91e-54	197	453	0.119	0.227	FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG PE=1 SV=3
17	P02675	1.95e-54	198	491	0.130	0.230	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
18	V9HVY1	1.95e-54	198	491	0.130	0.230	V9HVY1_HUMAN Epididymis secretory sperm binding protein Li 78p OS=Homo sapiens OX=9606 GN=HEL-S-78p PE=2 SV=1
19	Q02020	4.03e-54	197	463	0.122	0.229	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
20	Q5RH53	2.64e-53	195	480	0.114	0.206	Q5RH53_DANRE Angiopoietin-like 1a OS=Danio rerio OX=7955 GN=angptl1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19924 DUF6387	21	16.2	Family of unknown function (DUF6387)
2	PF12160 Fibrinogen_aC	8.5e-27	104.2	Fibrinogen alpha C domain
3	PF00147 Fibrinogen_C	3.3e-71	251.2	Fibrinogen beta and gamma chains, C-terminal globular domain
4	PF08702 Fib_alpha	1e-39	147.4	Fibrinogen alpha/beta chain family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306099	0.999	Fibrinogen beta chain
2	9606.ENSP00000308541	0.999	Prothrombin
3	9606.ENSP00000336829	0.999	Fibrinogen gamma chain
4	9606.ENSP00000356671	0.997	Antithrombin-III
5	9606.ENSP00000356382	0.991	Coagulation factor XIII B chain
6	9606.ENSP00000215727	0.978	Heparin cofactor 2
7	9606.ENSP00000234071	0.964	Vitamin K-dependent protein C
8	9606.ENSP00000333203	0.959	Plasma serine protease inhibitor
9	9606.ENSP00000265132	0.957	Protein AMBP
10	9606.ENSP00000452786	0.951	Integrin beta-3
11	9606.ENSP00000263408	0.944	Complement component C9
12	9606.ENSP00000293379	0.943	Integrin alpha-5
13	9606.ENSP00000361850	0.943	Urokinase-type plasminogen activator
14	9606.ENSP00000264870	0.934	Coagulation factor XIII A chain
15	9606.ENSP00000236850	0.933	Apolipoprotein A-I
16	9606.ENSP00000262407	0.933	Integrin alpha-IIb
17	9606.ENSP00000441691	0.932	Integrin alpha-M
18	9606.ENSP00000232003	0.921	Histidine-rich glycoprotein
19	9606.ENSP00000321853	0.916	Alpha-2-antiplasmin
20	9606.ENSP00000339328	0.916	Urokinase plasminogen activator surface receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005201	1.000	extracellular matrix structural constituent
GO:0050839	1.000	cell adhesion molecule binding
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0032501	0.988	multicellular organismal process
GO:0006950	0.985	response to stress
GO:0042060	0.983	wound healing
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0050878	0.951	regulation of body fluid levels
GO:0051239	0.946	regulation of multicellular organismal process
GO:0050817	0.944	coagulation
GO:0048583	0.936	regulation of response to stimulus
GO:0048518	0.924	positive regulation of biological process
GO:0048519	0.917	negative regulation of biological process
GO:0007596	0.911	blood coagulation
GO:0048522	0.882	positive regulation of cellular process
GO:0008152	0.881	metabolic process
GO:0071704	0.861	organic substance metabolic process
GO:0042221	0.851	response to chemical
GO:0050818	0.850	regulation of coagulation
GO:1900046	0.848	regulation of hemostasis
GO:0032102	0.828	negative regulation of response to external stimulus
GO:0061041	0.811	regulation of wound healing
GO:0044238	0.799	primary metabolic process
GO:0048523	0.793	negative regulation of cellular process
GO:0030193	0.792	regulation of blood coagulation
GO:0051241	0.787	negative regulation of multicellular organismal process
GO:0051050	0.770	positive regulation of transport
GO:1900047	0.768	negative regulation of hemostasis
GO:0023051	0.762	regulation of signaling
GO:0010646	0.762	regulation of cell communication
GO:0061045	0.755	negative regulation of wound healing
GO:0030195	0.739	negative regulation of blood coagulation
GO:0006807	0.693	nitrogen compound metabolic process
GO:0019222	0.682	regulation of metabolic process
GO:1903532	0.670	positive regulation of secretion by cell
GO:1901564	0.668	organonitrogen compound metabolic process
GO:0023056	0.668	positive regulation of signaling
GO:0010647	0.668	positive regulation of cell communication
GO:0044419	0.663	biological process involved in interspecies interaction between organisms
GO:0030155	0.663	regulation of cell adhesion
GO:0006952	0.657	defense response
GO:0060255	0.656	regulation of macromolecule metabolic process
GO:0048584	0.651	positive regulation of response to stimulus
GO:0080090	0.650	regulation of primary metabolic process
GO:0010033	0.646	response to organic substance
GO:0009605	0.643	response to external stimulus
GO:1901700	0.634	response to oxygen-containing compound
GO:0051171	0.630	regulation of nitrogen compound metabolic process
GO:0043170	0.580	macromolecule metabolic process
GO:0002791	0.538	regulation of peptide secretion
GO:0046883	0.533	regulation of hormone secretion
GO:0009966	0.532	regulation of signal transduction
GO:0051246	0.522	regulation of protein metabolic process
GO:0001775	0.495	cell activation
GO:0046887	0.491	positive regulation of hormone secretion
GO:0019538	0.482	protein metabolic process
GO:0043067	0.480	regulation of programmed cell death
GO:0010468	0.474	regulation of gene expression
GO:0090276	0.468	regulation of peptide hormone secretion
GO:0051240	0.450	positive regulation of multicellular organismal process
GO:0042981	0.449	regulation of apoptotic process
GO:0051716	0.446	cellular response to stimulus
GO:0090277	0.443	positive regulation of peptide hormone secretion
GO:0030168	0.435	platelet activation
GO:0007155	0.430	cell adhesion
GO:0009967	0.418	positive regulation of signal transduction
GO:0071840	0.406	cellular component organization or biogenesis
GO:1902531	0.405	regulation of intracellular signal transduction
GO:0003018	0.385	vascular process in circulatory system
GO:0016043	0.366	cellular component organization
GO:0060627	0.347	regulation of vesicle-mediated transport
GO:0097746	0.343	blood vessel diameter maintenance
GO:1903522	0.333	regulation of blood circulation
GO:0009892	0.332	negative regulation of metabolic process
GO:0010605	0.322	negative regulation of macromolecule metabolic process
GO:0060548	0.313	negative regulation of cell death
GO:0045907	0.311	positive regulation of vasoconstriction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0070013	0.998	intracellular organelle lumen
GO:0031982	0.996	vesicle
GO:0005886	0.994	plasma membrane
GO:0062023	0.989	collagen-containing extracellular matrix
GO:0005783	0.988	endoplasmic reticulum
GO:0032991	0.985	protein-containing complex
GO:0072562	0.968	blood microparticle
GO:0070062	0.947	extracellular exosome
GO:0031410	0.932	cytoplasmic vesicle
GO:0099503	0.886	secretory vesicle
GO:0030141	0.862	secretory granule
GO:0005788	0.805	endoplasmic reticulum lumen
GO:0009986	0.701	cell surface
GO:0031983	0.695	vesicle lumen
GO:0031091	0.695	platelet alpha granule
GO:0031093	0.667	platelet alpha granule lumen
GO:0098552	0.547	side of membrane
GO:0005577	0.467	fibrinogen complex
GO:0009897	0.450	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]