StarFunc result for job id P02675

User Input

>input (491 residues)
MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
SMKIRPFFPQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02675	1.000	1.000	3.668E-94	491	1.000	1.000	P02675.pdb.gz	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
2	AFDB:Q8K0E8	0.832	0.849	1.044E-80	481	0.819	0.836	Q8K0E8.pdb.gz	FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus OX=10090 GN=Fgb PE=1 SV=1
3	AFDB:P02676	0.810	0.849	8.002E-75	468	0.778	0.816	P02676.pdb.gz	FIBB_BOVIN Fibrinogen beta chain OS=Bos taurus OX=9913 GN=FGB PE=1 SV=2
4	PDB:3ghgB	0.752	0.911	1.755E-71	401	0.817	1.000	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
5	AFDB:Q02020	0.784	0.830	1.464E-69	463	0.617	0.654	Q02020.pdb.gz	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
6	AFDB:Q6NYE1	0.792	0.802	2.184E-65	485	0.544	0.551	Q6NYE1.pdb.gz	Q6NYE1_DANRE Fibrinogen beta chain OS=Danio rerio OX=7955 GN=wu:fa55c11 PE=1 SV=1
7	PDB:1m1jB	0.750	0.906	4.146E-63	402	0.562	0.687	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
8	AFDB:Q7ZVG7	0.484	0.550	2.362E-36	431	0.281	0.320	Q7ZVG7.pdb.gz	Q7ZVG7_DANRE Fgg protein OS=Danio rerio OX=7955 GN=fb60h05 PE=1 SV=1
9	AFDB:P02680	0.481	0.529	1.693E-35	445	0.277	0.306	P02680.pdb.gz	FIBG_RAT Fibrinogen gamma chain OS=Rattus norvegicus OX=10116 GN=Fgg PE=1 SV=3
10	AFDB:P02679	0.477	0.516	1.214E-34	453	0.287	0.311	P02679.pdb.gz	FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG PE=1 SV=3
11	AFDB:O93568	0.482	0.542	1.541E-34	435	0.269	0.303	O93568.pdb.gz	O93568_CHICK Fibrinogen gamma chain OS=Gallus gallus OX=9031 PE=1 SV=1
12	PDB:1ei3C	0.480	0.591	1.237E-33	397	0.255	0.315	1ei3C.pdb.gz
13	PDB:3ghgI	0.485	0.602	1.570E-33	394	0.269	0.335	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
14	AFDB:Q71KU9	0.455	0.703	7.654E-32	314	0.232	0.363	Q71KU9.pdb.gz	FGL1_MOUSE Fibrinogen-like protein 1 OS=Mus musculus OX=10090 GN=Fgl1 PE=1 SV=2
15	PDB:1jc9A	0.412	0.905	3.937E-25	220	0.181	0.405	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
16	PDB:4wmqA	0.164	0.263	1.338E-4	283	0.055	0.095	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.226	0.333	2.906E-4	281	0.102	0.178	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:5n0cA	0.078	0.043	2.327E-1	1293	0.073	0.028	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
19	PDB:3wqyA	0.083	0.054	5.696E-1	905	0.043	0.023	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
20	PDB:6hivDA	0.069	0.028	7.677E-1	1557	0.039	0.012	6hivDA.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6REL8	0.0	582	272	0.554	1.000	D6REL8_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=1
2	P02675	0.0	1033	491	1.000	1.000	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
3	P02676	0.0	822	468	0.774	0.812	FIBB_BOVIN Fibrinogen beta chain OS=Bos taurus OX=9913 GN=FGB PE=1 SV=2
4	P14480	0.0	809	479	0.776	0.795	FIBB_RAT Fibrinogen beta chain OS=Rattus norvegicus OX=10116 GN=Fgb PE=1 SV=4
5	Q02020	0.0	667	463	0.623	0.661	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
6	Q6NYE1	0.0	556	485	0.523	0.530	Q6NYE1_DANRE Fibrinogen beta chain OS=Danio rerio OX=7955 GN=wu:fa55c11 PE=1 SV=1
7	Q8K0E8	0.0	838	481	0.807	0.823	FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus OX=10090 GN=Fgb PE=1 SV=1
8	V9HVY1	0.0	1033	491	1.000	1.000	V9HVY1_HUMAN Epididymis secretory sperm binding protein Li 78p OS=Homo sapiens OX=9606 GN=HEL-S-78p PE=2 SV=1
9	Q7ZVG7	7.65e-74	241	431	0.279	0.318	Q7ZVG7_DANRE Fgg protein OS=Danio rerio OX=7955 GN=fb60h05 PE=1 SV=1
10	O93568	6.51e-72	236	435	0.281	0.317	O93568_CHICK Fibrinogen gamma chain OS=Gallus gallus OX=9031 PE=1 SV=1
11	P02679	4.25e-69	229	453	0.257	0.278	FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG PE=1 SV=3
12	P02680	1.01e-67	226	445	0.273	0.301	FIBG_RAT Fibrinogen gamma chain OS=Rattus norvegicus OX=10116 GN=Fgg PE=1 SV=3
13	Q8VCM7	1.11e-67	225	436	0.275	0.310	FIBG_MOUSE Fibrinogen gamma chain OS=Mus musculus OX=10090 GN=Fgg PE=1 SV=1
14	F1QG23	2.31e-64	213	335	0.230	0.337	F1QG23_DANRE Fibrinogen-like protein 1 isoform X2 OS=Danio rerio OX=7955 GN=si:ch211-287a12.9 PE=4 SV=2
15	P02671	9.26e-55	199	866	0.230	0.130	FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2
16	Q71KU9	1.01e-54	187	314	0.212	0.331	FGL1_MOUSE Fibrinogen-like protein 1 OS=Mus musculus OX=10090 GN=Fgl1 PE=1 SV=2
17	Q08830	4.88e-54	186	312	0.234	0.369	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3
18	E9PV24	2.52e-53	194	789	0.220	0.137	FIBA_MOUSE Fibrinogen alpha chain OS=Mus musculus OX=10090 GN=Fga PE=1 SV=1
19	Q5KQT9	2.04e-52	187	510	0.208	0.200	Q5KQT9_DANRE Angiopoietin-like 2 OS=Danio rerio OX=7955 GN=Angptl2 PE=2 SV=1
20	P14448	3.03e-52	190	741	0.226	0.150	FIBA_CHICK Fibrinogen alpha chain OS=Gallus gallus OX=9031 GN=FGA PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07888 CALCOCO1	3e+02	11.7	Calcium binding and coiled-coil domain (CALCOCO1) like
2	PF02601 Exonuc_VII_L	5.8e+02	11.4	Exonuclease VII, large subunit
3	PF00147 Fibrinogen_C	1.2e-93	324.5	Fibrinogen beta and gamma chains, C-terminal globular domain
4	PF08702 Fib_alpha	1.5e-43	159.8	Fibrinogen alpha/beta chain family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306361	0.999	Fibrinogen alpha chain
2	9606.ENSP00000336829	0.999	Fibrinogen gamma chain
3	9606.ENSP00000308541	0.997	Prothrombin
4	9606.ENSP00000356671	0.994	Antithrombin-III
5	9606.ENSP00000356382	0.987	Coagulation factor XIII B chain
6	9606.ENSP00000215727	0.971	Heparin cofactor 2
7	9606.ENSP00000333203	0.953	Plasma serine protease inhibitor
8	9606.ENSP00000263408	0.949	Complement component C9
9	9606.ENSP00000361850	0.948	Urokinase-type plasminogen activator
10	9606.ENSP00000234071	0.941	Vitamin K-dependent protein C
11	9606.ENSP00000452786	0.940	Integrin beta-3
12	9606.ENSP00000265132	0.937	Protein AMBP
13	9606.ENSP00000365081	0.931	Apolipoprotein M
14	9606.ENSP00000262407	0.924	Integrin alpha-IIb
15	9606.ENSP00000381133	0.918	Fibrinogen-like protein 1
16	9606.ENSP00000261023	0.911	Integrin alpha-V
17	9606.ENSP00000293379	0.909	Integrin alpha-5
18	9606.ENSP00000339328	0.909	Urokinase plasminogen activator surface receptor
19	9606.ENSP00000360683	0.908	Tyrosine-protein phosphatase non-receptor type 1
20	9606.ENSP00000441691	0.908	Integrin alpha-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.967	signaling receptor binding
GO:0050839	0.917	cell adhesion molecule binding
GO:0051087	0.495	chaperone binding
GO:0005201	0.484	extracellular matrix structural constituent

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050896	0.987	response to stimulus
GO:0032501	0.980	multicellular organismal process
GO:0009987	0.977	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0006950	0.964	response to stress
GO:0065008	0.962	regulation of biological quality
GO:0050878	0.948	regulation of body fluid levels
GO:0048518	0.947	positive regulation of biological process
GO:0050817	0.942	coagulation
GO:0007599	0.937	hemostasis
GO:0042060	0.935	wound healing
GO:0007596	0.922	blood coagulation
GO:0042221	0.921	response to chemical
GO:0051604	0.907	protein maturation
GO:0072376	0.903	protein activation cascade
GO:0048583	0.877	regulation of response to stimulus
GO:1903034	0.869	regulation of response to wounding
GO:0048522	0.835	positive regulation of cellular process
GO:0032102	0.834	negative regulation of response to external stimulus
GO:0061041	0.832	regulation of wound healing
GO:0051050	0.805	positive regulation of transport
GO:1903035	0.800	negative regulation of response to wounding
GO:0010646	0.792	regulation of cell communication
GO:0023051	0.791	regulation of signaling
GO:0051241	0.774	negative regulation of multicellular organismal process
GO:0030193	0.768	regulation of blood coagulation
GO:0061045	0.767	negative regulation of wound healing
GO:0009966	0.757	regulation of signal transduction
GO:0030155	0.756	regulation of cell adhesion
GO:0010033	0.753	response to organic substance
GO:0030195	0.731	negative regulation of blood coagulation
GO:0051716	0.661	cellular response to stimulus
GO:0023056	0.644	positive regulation of signaling
GO:0010647	0.634	positive regulation of cell communication
GO:0048584	0.623	positive regulation of response to stimulus
GO:0060341	0.610	regulation of cellular localization
GO:0051047	0.609	positive regulation of secretion
GO:0003018	0.603	vascular process in circulatory system
GO:0048523	0.602	negative regulation of cellular process
GO:1903532	0.579	positive regulation of secretion by cell
GO:0050714	0.573	positive regulation of protein secretion
GO:0097746	0.567	blood vessel diameter maintenance
GO:1902531	0.546	regulation of intracellular signal transduction
GO:0019229	0.536	regulation of vasoconstriction
GO:0002791	0.527	regulation of peptide secretion
GO:0071840	0.513	cellular component organization or biogenesis
GO:0002793	0.511	positive regulation of peptide secretion
GO:0051240	0.505	positive regulation of multicellular organismal process
GO:0010941	0.473	regulation of cell death
GO:0046883	0.452	regulation of hormone secretion
GO:0043067	0.446	regulation of programmed cell death
GO:0046887	0.431	positive regulation of hormone secretion
GO:0042981	0.403	regulation of apoptotic process
GO:0090277	0.371	positive regulation of peptide hormone secretion
GO:0045907	0.370	positive regulation of vasoconstriction
GO:0009967	0.367	positive regulation of signal transduction
GO:0019222	0.357	regulation of metabolic process
GO:0007155	0.351	cell adhesion
GO:0016043	0.338	cellular component organization
GO:0060255	0.322	regulation of macromolecule metabolic process
GO:0060548	0.315	negative regulation of cell death
GO:0043066	0.301	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005615	1.000	extracellular space
GO:0071944	0.998	cell periphery
GO:0012505	0.998	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.993	intracellular organelle lumen
GO:0062023	0.979	collagen-containing extracellular matrix
GO:0072562	0.976	blood microparticle
GO:0032991	0.937	protein-containing complex
GO:0005783	0.928	endoplasmic reticulum
GO:0016020	0.920	membrane
GO:0031982	0.913	vesicle
GO:0005886	0.903	plasma membrane
GO:1903561	0.903	extracellular vesicle
GO:0070062	0.886	extracellular exosome
GO:0031410	0.840	cytoplasmic vesicle
GO:0030141	0.720	secretory granule
GO:0005577	0.323	fibrinogen complex
GO:0005788	0.302	endoplasmic reticulum lumen
GO:0034774	0.301	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]