StarFunc result for job id P02679

User Input

>input (453 residues)
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQT
KVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM
KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKY
RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
GEGQQHHLGGAKQVRPEHPAETEYDSLYPEDDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02679	1.000	1.000	6.047E-87	453	1.000	1.000	P02679.pdb.gz	FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG PE=1 SV=3
2	AFDB:P02680	0.855	0.869	5.853E-76	445	0.799	0.813	P02680.pdb.gz	FIBG_RAT Fibrinogen gamma chain OS=Rattus norvegicus OX=10116 GN=Fgg PE=1 SV=3
3	PDB:3ghgI	0.704	0.806	1.073E-68	394	0.870	1.000	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
4	AFDB:O93568	0.727	0.752	5.917E-63	435	0.623	0.648	O93568.pdb.gz	O93568_CHICK Fibrinogen gamma chain OS=Gallus gallus OX=9031 PE=1 SV=1
5	AFDB:Q7ZVG7	0.843	0.884	1.102E-57	431	0.525	0.552	Q7ZVG7.pdb.gz	Q7ZVG7_DANRE Fgg protein OS=Danio rerio OX=7955 GN=fb60h05 PE=1 SV=1
6	PDB:1ei3C	0.702	0.795	5.492E-54	397	0.594	0.678	1ei3C.pdb.gz
7	AFDB:Q02020	0.517	0.506	2.712E-35	463	0.305	0.298	Q02020.pdb.gz	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
8	PDB:1m1jB	0.521	0.585	7.137E-35	402	0.300	0.338	1m1jB.pdb.gz	Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
9	AFDB:P02675	0.516	0.477	8.541E-35	491	0.291	0.269	P02675.pdb.gz	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
10	AFDB:Q8K0E8	0.525	0.495	1.562E-34	481	0.285	0.268	Q8K0E8.pdb.gz	FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus OX=10090 GN=Fgb PE=1 SV=1
11	AFDB:P02676	0.516	0.500	4.104E-34	468	0.289	0.280	P02676.pdb.gz	FIBB_BOVIN Fibrinogen beta chain OS=Bos taurus OX=9913 GN=FGB PE=1 SV=2
12	AFDB:Q6NYE1	0.515	0.482	5.550E-34	485	0.302	0.282	Q6NYE1.pdb.gz	Q6NYE1_DANRE Fibrinogen beta chain OS=Danio rerio OX=7955 GN=wu:fa55c11 PE=1 SV=1
13	PDB:3ghgB	0.517	0.582	3.174E-32	401	0.287	0.324	3ghgB.pdb.gz	Crystal structure of human fibrinogen.
14	AFDB:Q1RLR4	0.504	0.656	6.540E-32	345	0.267	0.351	Q1RLR4.pdb.gz
15	PDB:1jc9A	0.448	0.905	1.331E-22	220	0.192	0.395	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
16	PDB:4wmqA	0.266	0.372	2.661E-4	283	0.084	0.134	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
17	PDB:5zc0A	0.170	0.253	6.144E-3	281	0.038	0.060	5zc0A.pdb.gz	Structural stabilities of calcium proteins: Human intelectin-1 and frog lectin XEEL
18	PDB:6l08A	0.047	0.072	3.959E-1	285	0.013	0.021	6l08A.pdb.gz
19	PDB:1pdpA	0.109	0.158	6.816E-1	288	0.031	0.049	1pdpA.pdb.gz
20	PDB:1z7qF	0.051	0.085	7.241E-1	234	0.029	0.056	1z7qF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O93568	0.0	616	435	0.631	0.657	O93568_CHICK Fibrinogen gamma chain OS=Gallus gallus OX=9031 PE=1 SV=1
2	P02679	0.0	954	453	1.000	1.000	FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG PE=1 SV=3
3	P02680	0.0	788	445	0.810	0.825	FIBG_RAT Fibrinogen gamma chain OS=Rattus norvegicus OX=10116 GN=Fgg PE=1 SV=3
4	Q7ZVG7	0.0	515	431	0.530	0.557	Q7ZVG7_DANRE Fgg protein OS=Danio rerio OX=7955 GN=fb60h05 PE=1 SV=1
5	Q8VCM7	0.0	771	436	0.797	0.828	FIBG_MOUSE Fibrinogen gamma chain OS=Mus musculus OX=10090 GN=Fgg PE=1 SV=1
6	Q02020	1.13e-73	240	463	0.302	0.296	FIBB_CHICK Fibrinogen beta chain (Fragment) OS=Gallus gallus OX=9031 GN=FGB PE=1 SV=1
7	Q6NYE1	1.17e-70	233	485	0.285	0.266	Q6NYE1_DANRE Fibrinogen beta chain OS=Danio rerio OX=7955 GN=wu:fa55c11 PE=1 SV=1
8	P02676	2.61e-70	232	468	0.283	0.274	FIBB_BOVIN Fibrinogen beta chain OS=Bos taurus OX=9913 GN=FGB PE=1 SV=2
9	P02675	3.56e-69	229	491	0.283	0.261	FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2
10	V9HVY1	3.56e-69	229	491	0.283	0.261	V9HVY1_HUMAN Epididymis secretory sperm binding protein Li 78p OS=Homo sapiens OX=9606 GN=HEL-S-78p PE=2 SV=1
11	F1QG23	2.47e-68	223	335	0.296	0.400	F1QG23_DANRE Fibrinogen-like protein 1 isoform X2 OS=Danio rerio OX=7955 GN=si:ch211-287a12.9 PE=4 SV=2
12	Q8K0E8	4.81e-68	226	481	0.283	0.266	FIBB_MOUSE Fibrinogen beta chain OS=Mus musculus OX=10090 GN=Fgb PE=1 SV=1
13	P14480	1.42e-67	225	479	0.285	0.269	FIBB_RAT Fibrinogen beta chain OS=Rattus norvegicus OX=10116 GN=Fgb PE=1 SV=4
14	Q08830	2.50e-63	209	312	0.263	0.381	FGL1_HUMAN Fibrinogen-like protein 1 OS=Homo sapiens OX=9606 GN=FGL1 PE=1 SV=3
15	Q71KU9	5.95e-63	208	314	0.258	0.373	FGL1_MOUSE Fibrinogen-like protein 1 OS=Mus musculus OX=10090 GN=Fgl1 PE=1 SV=2
16	D6REL8	1.28e-62	206	272	0.234	0.390	D6REL8_HUMAN Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=1
17	P14448	1.76e-56	201	741	0.241	0.147	FIBA_CHICK Fibrinogen alpha chain OS=Gallus gallus OX=9031 GN=FGA PE=1 SV=4
18	E9PV24	6.95e-56	200	789	0.227	0.131	FIBA_MOUSE Fibrinogen alpha chain OS=Mus musculus OX=10090 GN=Fga PE=1 SV=1
19	P02671	4.40e-55	198	866	0.227	0.119	FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2
20	B8A5L6	7.04e-55	196	684	0.230	0.152	B8A5L6_DANRE Fibrinogen alpha chain OS=Danio rerio OX=7955 GN=sb:cb892 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16574 CEP209_CC5	58	15.2	Coiled-coil region of centrosome protein CE290
2	PF18504 Csm1_N	9.9e+02	11.5	Csm1 N-terminal domain
3	PF13125 DUF3958	8.1e+02	11.7	Protein of unknown function (DUF3958)
4	PF00147 Fibrinogen_C	1.2e-93	324.5	Fibrinogen beta and gamma chains, C-terminal globular domain
5	PF08702 Fib_alpha	1.1e-44	163.6	Fibrinogen alpha/beta chain family
6	PF12329 TMF_DNA_bd	4.5e+02	12.3	TATA element modulatory factor 1 DNA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306099	0.999	Fibrinogen beta chain
2	9606.ENSP00000306361	0.999	Fibrinogen alpha chain
3	9606.ENSP00000308541	0.998	Prothrombin
4	9606.ENSP00000356671	0.997	Antithrombin-III
5	9606.ENSP00000356382	0.987	Coagulation factor XIII B chain
6	9606.ENSP00000215727	0.981	Heparin cofactor 2
7	9606.ENSP00000265132	0.975	Protein AMBP
8	9606.ENSP00000452786	0.975	Integrin beta-3
9	9606.ENSP00000333203	0.958	Plasma serine protease inhibitor
10	9606.ENSP00000205948	0.951	Beta-2-glycoprotein 1
11	9606.ENSP00000234071	0.951	Vitamin K-dependent protein C
12	9606.ENSP00000263408	0.945	Complement component C9
13	9606.ENSP00000361850	0.940	Urokinase-type plasminogen activator
14	9606.ENSP00000441691	0.936	Integrin alpha-M
15	9606.ENSP00000261023	0.933	Integrin alpha-V
16	9606.ENSP00000293379	0.933	Integrin alpha-5
17	9606.ENSP00000381133	0.929	Fibrinogen-like protein 1
18	9606.ENSP00000393887	0.926	Alpha-2-HS-glycoprotein
19	9606.ENSP00000265983	0.920	Hemopexin
20	9606.ENSP00000262407	0.919	Integrin alpha-IIb

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.958	signaling receptor binding
GO:0005201	0.950	extracellular matrix structural constituent
GO:0050839	0.948	cell adhesion molecule binding
GO:0042802	0.763	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0050789	0.989	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0048583	0.972	regulation of response to stimulus
GO:0048519	0.971	negative regulation of biological process
GO:0065008	0.969	regulation of biological quality
GO:0051239	0.961	regulation of multicellular organismal process
GO:0071704	0.955	organic substance metabolic process
GO:0080134	0.954	regulation of response to stress
GO:0050818	0.947	regulation of coagulation
GO:1900046	0.946	regulation of hemostasis
GO:0030195	0.935	negative regulation of blood coagulation
GO:0044238	0.930	primary metabolic process
GO:0032501	0.928	multicellular organismal process
GO:0006950	0.925	response to stress
GO:0048523	0.917	negative regulation of cellular process
GO:0030155	0.912	regulation of cell adhesion
GO:0043170	0.886	macromolecule metabolic process
GO:0022407	0.877	regulation of cell-cell adhesion
GO:0050817	0.871	coagulation
GO:0007596	0.850	blood coagulation
GO:0006807	0.848	nitrogen compound metabolic process
GO:0042221	0.834	response to chemical
GO:0060627	0.820	regulation of vesicle-mediated transport
GO:0048518	0.816	positive regulation of biological process
GO:1901564	0.811	organonitrogen compound metabolic process
GO:0051716	0.810	cellular response to stimulus
GO:1902531	0.784	regulation of intracellular signal transduction
GO:0051604	0.784	protein maturation
GO:0007155	0.778	cell adhesion
GO:0051050	0.764	positive regulation of transport
GO:0048522	0.761	positive regulation of cellular process
GO:0051179	0.753	localization
GO:0043408	0.746	regulation of MAPK cascade
GO:0072376	0.719	protein activation cascade
GO:0048584	0.702	positive regulation of response to stimulus
GO:0042981	0.695	regulation of apoptotic process
GO:0023056	0.675	positive regulation of signaling
GO:0010647	0.675	positive regulation of cell communication
GO:0051234	0.652	establishment of localization
GO:0051240	0.640	positive regulation of multicellular organismal process
GO:0098609	0.619	cell-cell adhesion
GO:0010033	0.607	response to organic substance
GO:0007162	0.592	negative regulation of cell adhesion
GO:0030168	0.581	platelet activation
GO:1904035	0.552	regulation of epithelial cell apoptotic process
GO:0006810	0.544	transport
GO:0045921	0.518	positive regulation of exocytosis
GO:0009967	0.504	positive regulation of signal transduction
GO:2001233	0.481	regulation of apoptotic signaling pathway
GO:0060341	0.476	regulation of cellular localization
GO:2001236	0.473	regulation of extrinsic apoptotic signaling pathway
GO:1902041	0.447	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0070527	0.447	platelet aggregation
GO:0050714	0.432	positive regulation of protein secretion
GO:0046883	0.397	regulation of hormone secretion
GO:0090277	0.391	positive regulation of peptide hormone secretion
GO:0071840	0.369	cellular component organization or biogenesis
GO:0048856	0.367	anatomical structure development
GO:0019222	0.350	regulation of metabolic process
GO:2000351	0.331	regulation of endothelial cell apoptotic process
GO:0016043	0.328	cellular component organization
GO:0006508	0.326	proteolysis
GO:0060548	0.323	negative regulation of cell death
GO:0060255	0.322	regulation of macromolecule metabolic process
GO:0043066	0.314	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.998	cell periphery
GO:0005737	0.998	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0070013	0.992	intracellular organelle lumen
GO:0072562	0.991	blood microparticle
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0031012	0.982	extracellular matrix
GO:0032991	0.979	protein-containing complex
GO:0016020	0.909	membrane
GO:0031982	0.868	vesicle
GO:0030141	0.849	secretory granule
GO:1903561	0.797	extracellular vesicle
GO:0070062	0.784	extracellular exosome
GO:0005886	0.780	plasma membrane
GO:0062023	0.686	collagen-containing extracellular matrix
GO:0005783	0.619	endoplasmic reticulum
GO:0034774	0.494	secretory granule lumen
GO:0005788	0.344	endoplasmic reticulum lumen
GO:0031093	0.314	platelet alpha granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]