StarFunc result for job id P02689

User Input

>input (132 residues)
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKN
TEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKM
KGVVCTRIYEKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02689	1.000	1.000	2.128E-23	132	1.000	1.000	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
2	PDB:3nr3A	0.982	0.960	7.880E-22	135	0.985	0.963	3nr3A.pdb.gz
3	AFDB:P24526	0.998	0.998	6.886E-21	132	0.871	0.871	P24526.pdb.gz	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
4	AFDB:F1MHQ4	0.989	0.989	1.027E-18	132	0.689	0.689	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
5	AFDB:O97788	0.987	0.987	1.635E-18	132	0.682	0.682	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
6	AFDB:Q0Z7S8	0.992	0.992	1.908E-18	132	0.674	0.674	Q0Z7S8.pdb.gz	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
7	AFDB:P05413	0.992	0.984	2.116E-18	133	0.629	0.624	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
8	AFDB:A0A0K0MJN3	0.991	0.991	2.346E-18	132	0.644	0.644	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
9	AFDB:P07483	0.991	0.984	3.036E-18	133	0.614	0.609	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
10	PDB:2qm9A	0.961	0.913	3.928E-18	139	0.674	0.640	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
11	AFDB:P04117	0.985	0.985	3.930E-18	132	0.682	0.682	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
12	AFDB:A6NFH5	0.988	0.932	6.584E-18	140	0.659	0.621	A6NFH5.pdb.gz	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
13	PDB:5hz9A	0.978	0.956	8.969E-18	135	0.621	0.607	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
14	PDB:3p6dA	0.968	0.920	2.517E-17	139	0.659	0.626	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
15	PDB:4a60A	0.964	0.903	3.431E-17	141	0.659	0.617	4a60A.pdb.gz
16	PDB:7yf1A	0.984	0.976	4.005E-17	133	0.598	0.594	7yf1A.pdb.gz
17	PDB:5bvsA	0.961	0.961	4.923E-17	132	0.644	0.644	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
18	PDB:7e25A	0.974	0.926	1.312E-16	139	0.583	0.554	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
19	PDB:4azqA	0.975	0.947	2.199E-16	136	0.545	0.529	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
20	PDB:5ur9F	0.928	0.890	5.675E-15	138	0.561	0.536	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02689	1.92e-93	267	132	1.000	1.000	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
2	P24526	3.37e-82	239	132	0.871	0.871	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
3	F1MHQ4	3.46e-64	193	132	0.689	0.689	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
4	O97788	3.65e-64	193	132	0.682	0.682	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
5	P48035	1.30e-63	192	132	0.682	0.682	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
6	P04117	8.87e-63	189	132	0.682	0.682	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
7	A0A0K0MJN3	1.57e-62	189	132	0.644	0.644	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
8	P15090	2.04e-61	186	132	0.667	0.667	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
9	Q0Z7S8	2.32e-61	186	132	0.674	0.674	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
10	P70623	1.50e-59	181	132	0.644	0.644	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
11	P05413	9.22e-59	179	133	0.629	0.624	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
12	P07483	7.46e-57	174	133	0.614	0.609	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
13	P11404	5.02e-56	172	133	0.606	0.602	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
14	A6NFH5	1.14e-55	172	140	0.652	0.614	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
15	P55054	1.46e-52	164	132	0.598	0.598	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
16	O15540	2.09e-52	163	132	0.591	0.591	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
17	Q05423	4.13e-52	162	132	0.591	0.591	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
18	Q8UVG7	2.08e-50	158	133	0.545	0.541	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1
19	P55051	3.88e-50	157	132	0.568	0.568	FABP7_RAT Fatty acid-binding protein, brain OS=Rattus norvegicus OX=10116 GN=Fabp7 PE=1 SV=2
20	P51880	1.09e-49	156	132	0.561	0.561	FABP7_MOUSE Fatty acid-binding protein, brain OS=Mus musculus OX=10090 GN=Fabp7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	5.7e-22	89.9	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	1.4	20.3	Lipocalin / cytosolic fatty-acid binding protein family
3	PF17619 SCVP	1.1e+02	15.1	Secreted clade V proteins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220822	0.922	Ganglioside-induced differentiation-associated protein 1
2	9606.ENSP00000326018	0.769	Periaxin
3	9606.ENSP00000304956	0.730	Transcriptional activator MN1
4	9606.ENSP00000357051	0.721	Peroxisomal biogenesis factor 19
5	9606.ENSP00000285930	0.697	Aldose reductase
6	9606.ENSP00000234590	0.694	Alpha-enolase
7	9606.ENSP00000304229	0.690	Histidine triad nucleotide-binding protein 1
8	9606.ENSP00000380557	0.677	A-kinase anchor protein 8-like
9	9606.ENSP00000363513	0.669	Noncompact myelin-associated protein
10	9606.ENSP00000316042	0.667	Heterogeneous nuclear ribonucleoprotein A0
11	9606.ENSP00000245206	0.666	Aspartate aminotransferase, mitochondrial
12	9606.ENSP00000412388	0.664	Uncharacterized protein C9orf172
13	9606.ENSP00000360214	0.658	Opalin
14	9606.ENSP00000276480	0.657	Suppression of tumorigenicity 18 protein
15	9606.ENSP00000414019	0.616	Glycerophosphoinositol inositolphosphodiesterase GDPD2
16	9606.ENSP00000432943	0.610	Myelin protein P0
17	9606.ENSP00000295834	0.609	Fatty acid-binding protein, liver
18	9606.ENSP00000377549	0.598	Gastrotropin
19	9606.ENSP00000331210	0.593	Brevican core protein
20	9606.ENSP00000372654	0.583	Aquaporin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005504	0.999	fatty acid binding
GO:0005515	0.995	protein binding
GO:0036041	0.502	long-chain fatty acid binding
GO:0005501	0.449	retinoid binding
GO:0097159	0.312	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0071840	0.847	cellular component organization or biogenesis
GO:0016043	0.844	cellular component organization
GO:0061024	0.705	membrane organization
GO:0065007	0.677	biological regulation
GO:0050789	0.571	regulation of biological process
GO:0050794	0.546	regulation of cellular process
GO:0032502	0.325	developmental process
GO:0008152	0.316	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005622	0.999	intracellular anatomical structure
GO:0005737	0.991	cytoplasm
GO:0005576	0.950	extracellular region
GO:0070062	0.942	extracellular exosome
GO:0043229	0.879	intracellular organelle
GO:0005634	0.826	nucleus
GO:0005829	0.583	cytosol
GO:0016020	0.351	membrane
GO:0043233	0.303	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]