StarFunc result for job id P02708

User Input

>input (482 residues)
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02708	1.000	1.000	4.579E-86	482	1.000	1.000	P02708.pdb.gz	ACHA_HUMAN Acetylcholine receptor subunit alpha OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=3
2	AFDB:P02710	0.902	0.943	1.191E-67	461	0.732	0.766	P02710.pdb.gz	ACHA_TETCF Acetylcholine receptor subunit alpha OS=Tetronarce californica OX=7787 GN=CHRNA1 PE=1 SV=1
3	AFDB:Q98880	0.905	0.955	9.952E-67	456	0.730	0.772	Q98880.pdb.gz	ACHA_DANRE Acetylcholine receptor subunit alpha OS=Danio rerio OX=7955 GN=chrna1 PE=2 SV=1
4	AFDB:E7ENE5	0.741	0.944	3.763E-61	377	0.780	0.997	E7ENE5.pdb.gz	E7ENE5_HUMAN Cholinergic receptor nicotinic alpha 1 subunit OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=1
5	AFDB:P09481	0.796	0.774	2.905E-51	496	0.475	0.462	P09481.pdb.gz	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
6	AFDB:B8ZZD3	0.613	0.769	1.555E-49	375	0.776	0.997	B8ZZD3.pdb.gz	B8ZZD3_HUMAN Cholinergic receptor nicotinic alpha 1 subunit OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=1
7	AFDB:P32297	0.826	0.789	2.643E-49	505	0.475	0.453	P32297.pdb.gz	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
8	AFDB:Q15825	0.837	0.817	1.051E-48	494	0.442	0.431	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
9	AFDB:Q2MKA5	0.795	0.820	5.162E-48	467	0.417	0.430	Q2MKA5.pdb.gz	ACHA5_MOUSE Neuronal acetylcholine receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Chrna5 PE=2 SV=1
10	AFDB:P30532	0.799	0.823	2.163E-47	468	0.421	0.434	P30532.pdb.gz	ACHA5_HUMAN Neuronal acetylcholine receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=CHRNA5 PE=1 SV=2
11	PDB:4aq5E	0.606	0.762	4.871E-21	370	0.299	0.389	4aq5E.pdb.gz
12	PDB:6i53B	0.564	0.789	2.109E-19	338	0.147	0.210	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:6i53A	0.560	0.758	1.858E-18	349	0.137	0.189	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:2w8gC	0.392	0.838	3.196E-16	217	0.098	0.217	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
15	PDB:4hfcA	0.463	0.693	4.167E-16	311	0.108	0.167	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
16	PDB:7kuyE	0.499	0.690	5.613E-15	338	0.133	0.189	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
17	PDB:4afhA	0.368	0.799	1.119E-14	213	0.122	0.277	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.452	0.682	4.746E-12	311	0.114	0.177	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.441	0.699	2.409E-10	288	0.120	0.201	6zgdA.pdb.gz
20	PDB:7nupD	0.116	0.076	6.228E-2	884	0.039	0.021	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV17	0.0	602	294	0.610	1.000	A0A1B0GV17_HUMAN Cholinergic receptor nicotinic alpha 1 subunit OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=2
2	B8ZZD3	0.0	613	375	0.618	0.795	B8ZZD3_HUMAN Cholinergic receptor nicotinic alpha 1 subunit OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=1
3	E7ENE5	0.0	674	377	0.693	0.886	E7ENE5_HUMAN Cholinergic receptor nicotinic alpha 1 subunit OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=1
4	G5E9G9	0.0	529	269	0.539	0.967	G5E9G9_HUMAN Cholinergic receptor nicotinic alpha 1 subunit OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=1
5	P02708	0.0	926	457	0.948	1.000	ACHA_HUMAN Acetylcholine receptor subunit alpha OS=Homo sapiens OX=9606 GN=CHRNA1 PE=1 SV=3
6	P02710	0.0	744	461	0.747	0.781	ACHA_TETCF Acetylcholine receptor subunit alpha OS=Tetronarce californica OX=7787 GN=CHRNA1 PE=1 SV=1
7	P02711	0.0	740	461	0.743	0.777	ACHA_TORMA Acetylcholine receptor subunit alpha OS=Torpedo marmorata OX=7788 GN=CHRNA1 PE=1 SV=1
8	P04756	0.0	845	457	0.882	0.930	ACHA_MOUSE Acetylcholine receptor subunit alpha OS=Mus musculus OX=10090 GN=Chrna1 PE=1 SV=1
9	P25108	0.0	842	457	0.878	0.926	ACHA_RAT Acetylcholine receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Chrna1 PE=2 SV=1
10	Q53SH4	0.0	926	457	0.948	1.000	Q53SH4_HUMAN Cholinergic receptor, nicotinic, alpha 1 (Muscle), isoform CRA_a OS=Homo sapiens OX=9606 GN=CHRNA1 PE=2 SV=1
11	Q98880	0.0	694	456	0.726	0.768	ACHA_DANRE Acetylcholine receptor subunit alpha OS=Danio rerio OX=7955 GN=chrna1 PE=2 SV=1
12	P09481	1.82e-147	432	496	0.485	0.472	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
13	Q8R4G9	3.31e-147	432	499	0.469	0.453	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1
14	P32297	6.93e-147	431	505	0.467	0.446	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
15	P04757	1.37e-146	430	499	0.473	0.457	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1
16	Q9R0W9	1.17e-139	412	494	0.438	0.427	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
17	Q15825	3.37e-137	406	494	0.438	0.427	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
18	P43143	1.04e-134	400	493	0.432	0.422	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
19	Q1RLX8	5.01e-130	389	520	0.461	0.427	Q1RLX8_DANRE Cholinergic receptor, nicotinic, alpha 2a (neuronal) OS=Danio rerio OX=7955 GN=zgc:136717 PE=2 SV=1
20	A0A0X1KG79	1.40e-128	384	507	0.444	0.422	A0A0X1KG79_HUMAN Cholinergic receptor nicotinic alpha 2 subunit OS=Homo sapiens OX=9606 GN=CHRNA2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	2.9e-60	214.9	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	4.7e-65	231.6	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298854	0.979	43 kDa receptor-associated protein of the synapse
2	9606.ENSP00000368678	0.943	Agrin
3	9606.ENSP00000306490	0.938	Muscarinic acetylcholine receptor M1
4	9606.ENSP00000356515	0.922	Utrophin
5	9606.ENSP00000354923	0.917	Dystrophin
6	9606.ENSP00000400365	0.913	Laminin subunit alpha-2
7	9606.ENSP00000355645	0.912	Actin, alpha skeletal muscle
8	9606.ENSP00000388325	0.908	Laminin subunit beta-2
9	9606.ENSP00000481878	0.906	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
10	9606.ENSP00000252999	0.905	Laminin subunit alpha-5
11	9606.ENSP00000442600	0.905	Dystroglycan
12	9606.ENSP00000222399	0.904	Laminin subunit beta-1
13	9606.ENSP00000360266	0.903	Transcription factor AP-1
14	9606.ENSP00000362680	0.903	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000375778	0.902	Laminin subunit beta-3
16	9606.ENSP00000379350	0.902	Integrin beta-1
17	9606.ENSP00000329357	0.901	Transcription factor Sp1
18	9606.ENSP00000341189	0.901	Focal adhesion kinase 1
19	9606.ENSP00000230538	0.900	Laminin subunit alpha-4
20	9606.ENSP00000244007	0.900	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	0.999	acetylcholine-gated monoatomic cation-selective channel activity
GO:0004888	0.991	transmembrane signaling receptor activity
GO:0005488	0.989	binding
GO:0005515	0.975	protein binding
GO:0015464	0.965	acetylcholine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050896	0.993	response to stimulus
GO:0009987	0.992	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.959	regulation of cellular process
GO:0023052	0.938	signaling
GO:0042391	0.937	regulation of membrane potential
GO:0007154	0.936	cell communication
GO:0042221	0.897	response to chemical
GO:0007267	0.815	cell-cell signaling
GO:0051716	0.810	cellular response to stimulus
GO:0099536	0.722	synaptic signaling
GO:0032501	0.620	multicellular organismal process
GO:0007165	0.594	signal transduction
GO:0032502	0.311	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098796	0.995	membrane protein complex
GO:0098797	0.993	plasma membrane protein complex
GO:0043235	0.974	receptor complex
GO:0098802	0.962	plasma membrane signaling receptor complex
GO:0034702	0.955	ion channel complex
GO:0005892	0.898	acetylcholine-gated channel complex
GO:0043226	0.605	organelle
GO:0005622	0.487	intracellular anatomical structure
GO:0043231	0.319	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]