StarFunc result for job id P02730

User Input

>input (911 residues)
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVE
LQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVL
LDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTR
SGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQP
VLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYM
AQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
GLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPA
ITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCE
TNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKL
IKIFQDHPLQKTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGK
LRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFP
IWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFG
MPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPIL
SRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQ
IICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEG
RDEYDEVAMPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7tvzA	0.573	0.613	0.000	850	0.932	0.999	7tvzA.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
2	PDB:8cs9g	0.567	0.620	0.000	832	0.910	0.996	8cs9g.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
3	AFDB:P02730	1.000	1.000	0.000	911	1.000	1.000	P02730.pdb.gz	B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3
4	AFDB:P04919	0.621	0.609	0.000	929	0.823	0.807	P04919.pdb.gz	B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus OX=10090 GN=Slc4a1 PE=1 SV=1
5	AFDB:B0S7B8	0.587	0.439	1.035E-89	1228	0.576	0.428	B0S7B8.pdb.gz	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
6	AFDB:P48751	0.581	0.432	9.398E-89	1232	0.565	0.418	P48751.pdb.gz	B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens OX=9606 GN=SLC4A3 PE=1 SV=2
7	AFDB:P04920	0.581	0.429	2.173E-88	1241	0.585	0.429	P04920.pdb.gz	B3A2_HUMAN Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4
8	AFDB:A9NIM6	0.555	0.420	1.653E-87	1232	0.594	0.439	A9NIM6.pdb.gz	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
9	AFDB:A0A096X8J7	0.558	0.443	2.009E-84	1170	0.546	0.425	A0A096X8J7.pdb.gz	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
10	AFDB:B3DKQ1	0.536	0.539	1.038E-79	905	0.516	0.519	B3DKQ1.pdb.gz
11	AFDB:D1FTM8	0.587	0.626	3.127E-79	851	0.496	0.531	D1FTM8.pdb.gz	D1FTM8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a1b PE=2 SV=1
12	AFDB:Q9VT48	0.559	0.407	5.966E-72	1268	0.428	0.308	Q9VT48.pdb.gz	Q9VT48_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ae2 PE=1 SV=2
13	PDB:4yzfA	0.514	0.981	1.729E-53	475	0.518	0.994	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
14	PDB:6caaA	0.474	0.884	5.154E-26	477	0.228	0.436	6caaA.pdb.gz
15	PDB:5l25A	0.366	0.772	8.182E-13	399	0.120	0.273	5l25A.pdb.gz
16	PDB:7lguA	0.346	0.448	2.382E-8	680	0.076	0.101	7lguA.pdb.gz	Molecular mechanism of prestin electromotive signal amplification.
17	PDB:5i6cA	0.278	0.463	5.658E-6	480	0.082	0.156	5i6cA.pdb.gz	Structure of eukaryotic purine/H(+) symporter UapA suggests a role for homodimerization in transport activity.
18	PDB:7ch1A	0.299	0.403	1.561E-5	640	0.077	0.109	7ch1A.pdb.gz	Structural insights into the gating mechanism of human SLC26A9 mediated by its C-terminal sequence.
19	PDB:3qe7A	0.242	0.446	5.610E-5	407	0.082	0.184	3qe7A.pdb.gz	Structure and mechanism of the uracil transporter UraA
20	PDB:1a6jB	0.135	0.667	2.583E-2	157	0.032	0.185	1a6jB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096X8J7	989	1170	0.554	0.432	B3A3_DANRE Anion exchange protein 3 OS=Danio rerio OX=7955 GN=Slc4a3 PE=2 SV=1
2	A0A2R8QD45	561	1073	0.364	0.309	A0A2R8QD45_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=id:ibd2520 PE=1 SV=1
3	A9NIM6	1068	1232	0.595	0.440	A9NIM6_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2.1 PE=1 SV=1
4	B0S7B8	1013	1228	0.574	0.426	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1
5	D1FTM8	907	851	0.514	0.550	D1FTM8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a1b PE=2 SV=1
6	M9PB59	566	1134	0.371	0.298	M9PB59_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
7	M9PB60	565	1126	0.372	0.301	M9PB60_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
8	M9PC92	566	1086	0.371	0.311	M9PC92_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
9	M9PCF0	562	1067	0.368	0.314	M9PCF0_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
10	M9PCT2	571	1027	0.360	0.319	M9PCT2_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
11	M9PF01	562	1053	0.362	0.313	M9PF01_DROME Anion exchange protein OS=Drosophila melanogaster OX=7227 GN=Ndae1 PE=1 SV=1
12	P02730	1840	911	1.000	1.000	B3AT_HUMAN Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3
13	P04919	1454	929	0.824	0.808	B3AT_MOUSE Band 3 anion transport protein OS=Mus musculus OX=10090 GN=Slc4a1 PE=1 SV=1
14	P04920	983	1241	0.593	0.435	B3A2_HUMAN Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4
15	P13808	988	1237	0.593	0.437	B3A2_MOUSE Anion exchange protein 2 OS=Mus musculus OX=10090 GN=Slc4a2 PE=1 SV=1
16	P16283	923	1227	0.559	0.415	B3A3_MOUSE Anion exchange protein 3 OS=Mus musculus OX=10090 GN=Slc4a3 PE=1 SV=2
17	P23347	972	1234	0.592	0.437	B3A2_RAT Anion exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Slc4a2 PE=1 SV=1
18	P23348	920	1227	0.560	0.416	B3A3_RAT Anion exchange protein 3 OS=Rattus norvegicus OX=10116 GN=Slc4a3 PE=1 SV=1
19	P23562	1444	927	0.821	0.807	B3AT_RAT Band 3 anion transport protein OS=Rattus norvegicus OX=10116 GN=Slc4a1 PE=1 SV=3
20	P48751	914	1232	0.560	0.414	B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens OX=9606 GN=SLC4A3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07565 Band_3_cyto	8.6e-94	325.8	Band 3 cytoplasmic domain
2	PF00955 HCO3_cotransp	2.7e-188	638.5	HCO3- transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354003	0.982	Glycophorin-A
2	9606.ENSP00000300215	0.946	Erythrocyte membrane protein band 4.2
3	9606.ENSP00000285379	0.933	Carbonic anhydrase 2
4	9606.ENSP00000265709	0.926	Ankyrin-1
5	9606.ENSP00000332369	0.920	5-aminolevulinate synthase, erythroid-specific, mitochondrial
6	9606.ENSP00000345259	0.897	Protein 4.1
7	9606.ENSP00000307199	0.881	Alpha-hemoglobin-stabilizing protein
8	9606.ENSP00000427690	0.854	Glycophorin-B
9	9606.ENSP00000357129	0.797	Spectrin alpha chain, erythrocytic 1
10	9606.ENSP00000360217	0.793	Ammonium transporter Rh type A
11	9606.ENSP00000259254	0.781	Glycophorin-C
12	9606.ENSP00000430656	0.780	Carbonic anhydrase 1
13	9606.ENSP00000397261	0.754	Selenium-binding protein 1
14	9606.ENSP00000369654	0.744	Hemoglobin subunit delta
15	9606.ENSP00000427866	0.737	Dematin
16	9606.ENSP00000232744	0.728	Ankyrin repeat and BTB/POZ domain-containing protein 1
17	9606.ENSP00000234396	0.721	V-type proton ATPase subunit B, kidney isoform
18	9606.ENSP00000308122	0.711	V-type proton ATPase 116 kDa subunit a isoform 4
19	9606.ENSP00000451752	0.695	Spectrin beta chain, erythrocytic
20	9606.ENSP00000286713	0.685	Erythrocyte band 7 integral membrane protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030506	0.999	ankyrin binding
GO:0015291	0.999	secondary active transmembrane transporter activity
GO:0022853	0.999	active monoatomic ion transmembrane transporter activity
GO:0015106	0.999	bicarbonate transmembrane transporter activity
GO:0015108	0.999	chloride transmembrane transporter activity
GO:0005452	0.981	solute:inorganic anion antiporter activity
GO:0022890	0.721	inorganic cation transmembrane transporter activity
GO:0008324	0.605	monoatomic cation transmembrane transporter activity
GO:0046873	0.602	metal ion transmembrane transporter activity
GO:0015081	0.584	sodium ion transmembrane transporter activity
GO:0042802	0.457	identical protein binding
GO:0140900	0.444	chloride:bicarbonate antiporter activity
GO:0015293	0.415	symporter activity
GO:0140410	0.410	solute:bicarbonate symporter activity
GO:0015294	0.383	solute:monoatomic cation symporter activity
GO:0008510	0.374	sodium:bicarbonate symporter activity
GO:0043495	0.333	protein-membrane adaptor activity
GO:0046983	0.313	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051234	0.995	establishment of localization
GO:0006811	0.987	monoatomic ion transport
GO:0006820	0.972	monoatomic anion transport
GO:0009987	0.943	cellular process
GO:0019755	0.670	one-carbon compound transport
GO:0065007	0.413	biological regulation
GO:0042592	0.383	homeostatic process
GO:0015698	0.318	inorganic anion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098590	0.992	plasma membrane region
GO:0043226	0.989	organelle
GO:0005622	0.989	intracellular anatomical structure
GO:0045178	0.981	basal part of cell
GO:0043229	0.977	intracellular organelle
GO:0009925	0.941	basal plasma membrane
GO:0043232	0.935	intracellular non-membrane-bounded organelle
GO:0016323	0.930	basolateral plasma membrane
GO:0005737	0.913	cytoplasm
GO:0043231	0.767	intracellular membrane-bounded organelle
GO:0070013	0.346	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28695	0.999	hydrogencarbonate(in) = hydrogencarbonate(out)
RHEA:29823	0.999	chloride(in) = chloride(out)
RHEA:34963	0.584	Na(+)(in) = Na(+)(out)

[back to server]