StarFunc result for job id P02741

User Input

>input (224 residues)
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02741	1.000	1.000	9.994E-46	224	1.000	1.000	P02741.pdb.gz	CRP_HUMAN C-reactive protein OS=Homo sapiens OX=9606 GN=CRP PE=1 SV=1
2	PDB:1b09A	0.915	0.994	1.234E-37	206	0.920	1.000	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
3	AFDB:P48199	0.918	0.895	3.449E-33	230	0.665	0.648	P48199.pdb.gz	CRP_RAT C-reactive protein OS=Rattus norvegicus OX=10116 GN=Crp PE=1 SV=1
4	AFDB:P23680	0.898	0.882	1.675E-29	228	0.518	0.509	P23680.pdb.gz	SAMP_RAT Serum amyloid P-component OS=Rattus norvegicus OX=10116 GN=Apcs PE=2 SV=2
5	AFDB:P02743	0.900	0.904	2.079E-29	223	0.509	0.511	P02743.pdb.gz	SAMP_HUMAN Serum amyloid P-component OS=Homo sapiens OX=9606 GN=APCS PE=1 SV=2
6	PDB:2a3wA	0.881	0.966	3.860E-27	204	0.469	0.515	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
7	AFDB:Q7SZ53	0.862	0.869	1.022E-22	222	0.348	0.351	Q7SZ53.pdb.gz	Q7SZ53_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=si:ch211-234p6.13 PE=1 SV=2
8	AFDB:A3KPH8	0.855	0.851	2.427E-22	225	0.308	0.307	A3KPH8.pdb.gz
9	PDB:4pbpB	0.863	0.918	4.551E-22	210	0.304	0.324	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
10	AFDB:A3KPG5	0.859	0.863	5.173E-22	223	0.330	0.332	A3KPG5.pdb.gz	A3KPG5_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=crp3 PE=1 SV=1
11	AFDB:Q66I62	0.846	0.811	5.764E-22	234	0.344	0.329	Q66I62.pdb.gz
12	AFDB:Q9PTT2	0.818	0.815	1.297E-21	225	0.339	0.338	Q9PTT2.pdb.gz	JELT_LEPLA Jeltraxin OS=Lepidobatrachus laevis OX=8376 GN=PXN1 PE=1 SV=1
13	AFDB:X4Z0F0	0.865	0.843	1.699E-21	230	0.304	0.296	X4Z0F0.pdb.gz
14	PDB:7zl1A	0.790	0.822	2.237E-15	215	0.223	0.233	7zl1A.pdb.gz
15	PDB:7ufgB	0.626	0.137	1.641E-7	1182	0.129	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:7ufgA	0.588	0.133	5.392E-7	1151	0.138	0.027	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:8a7eC	0.607	0.102	1.149E-6	1524	0.152	0.022	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:3v0aB	0.531	0.119	6.142E-6	1150	0.107	0.021	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:3ffzA	0.483	0.104	5.636E-5	1246	0.125	0.022	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
20	PDB:5n0cA	0.444	0.088	2.853E-4	1293	0.134	0.023	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02741	2.68e-167	461	224	1.000	1.000	CRP_HUMAN C-reactive protein OS=Homo sapiens OX=9606 GN=CRP PE=1 SV=1
2	P48199	6.11e-108	311	230	0.665	0.648	CRP_RAT C-reactive protein OS=Rattus norvegicus OX=10116 GN=Crp PE=1 SV=1
3	P23680	7.83e-78	235	228	0.518	0.509	SAMP_RAT Serum amyloid P-component OS=Rattus norvegicus OX=10116 GN=Apcs PE=2 SV=2
4	P02743	2.09e-77	234	223	0.509	0.511	SAMP_HUMAN Serum amyloid P-component OS=Homo sapiens OX=9606 GN=APCS PE=1 SV=2
5	Q7SZ53	1.52e-45	152	222	0.348	0.351	Q7SZ53_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=si:ch211-234p6.13 PE=1 SV=2
6	Q0IIP8	1.63e-40	140	225	0.335	0.333	CRP_DANRE C-reactive protein OS=Danio rerio OX=7955 GN=crp PE=1 SV=1
7	A3KPG5	3.78e-39	136	223	0.326	0.327	A3KPG5_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=crp3 PE=1 SV=1
8	A3KPH5	7.77e-38	133	225	0.335	0.333	A3KPH5_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=CRP PE=3 SV=1
9	A7E2J1	5.21e-37	130	225	0.344	0.342	A7E2J1_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=CRP PE=2 SV=1
10	Q9PTT2	5.99e-37	130	225	0.330	0.329	JELT_LEPLA Jeltraxin OS=Lepidobatrachus laevis OX=8376 GN=PXN1 PE=1 SV=1
11	E9QB97	2.86e-18	85.1	530	0.250	0.106	E9QB97_DANRE Carbonic anhydrase OS=Danio rerio OX=7955 GN=ca6 PE=1 SV=1
12	H3BLN6	1.77e-17	82.0	372	0.228	0.137	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
13	Q6TLW1	2.12e-17	81.6	372	0.228	0.137	Q6TLW1_MOUSE Neuronal pentraxin 1.1 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
14	F8VQB8	3.90e-17	81.6	469	0.228	0.109	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
15	Q99J85	3.96e-17	81.6	493	0.228	0.103	NPTXR_MOUSE Neuronal pentraxin receptor OS=Mus musculus OX=10090 GN=Nptxr PE=1 SV=1
16	Q6TLW0	4.29e-17	81.3	469	0.228	0.109	Q6TLW0_MOUSE Neuronal pentraxin 1.4 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
17	O95502	4.94e-17	81.3	500	0.228	0.102	NPTXR_HUMAN Neuronal pentraxin receptor OS=Homo sapiens OX=9606 GN=NPTXR PE=3 SV=2
18	Q15818	7.72e-17	80.5	432	0.299	0.155	NPTX1_HUMAN Neuronal pentraxin-1 OS=Homo sapiens OX=9606 GN=NPTX1 PE=1 SV=2
19	Q6TKP2	1.34e-16	80.1	672	0.228	0.076	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
20	O35764	1.48e-16	80.1	494	0.214	0.097	NPTXR_RAT Neuronal pentraxin receptor OS=Rattus norvegicus OX=10116 GN=Nptxr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13385 Laminin_G_3	2.2e-07	42.6	Concanavalin A-like lectin/glucanases superfamily
2	PF00354 Pentaxin	1.6e-93	323.4	Pentaxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255030

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356399	0.998	Complement factor H
2	9606.ENSP00000358165	0.995	High affinity immunoglobulin gamma Fc receptor I
3	9606.ENSP00000271450	0.993	Low affinity immunoglobulin gamma Fc region receptor II-a
4	9606.ENSP00000360871	0.986	Ficolin-1
5	9606.ENSP00000309124	0.985	Oxidized low-density lipoprotein receptor 1
6	9606.ENSP00000356386	0.985	Complement factor H-related protein 4
7	9606.ENSP00000291744	0.981	Ficolin-2
8	9606.ENSP00000346839	0.961	Fibronectin type III domain containing
9	9606.ENSP00000312652	0.956	Leptin
10	9606.ENSP00000385035	0.950	Complement C1s subcomponent
11	9606.ENSP00000245907	0.947	Complement C3
12	9606.ENSP00000438615	0.944	Complement C1r subcomponent
13	9606.ENSP00000351497	0.925	Low affinity immunoglobulin gamma Fc region receptor II-b
14	9606.ENSP00000295897	0.921	Serum albumin
15	9606.ENSP00000396688	0.920	Complement C4-A
16	9606.ENSP00000385675	0.916	Interleukin-6
17	9606.ENSP00000380432	0.912	Insulin
18	9606.ENSP00000398698	0.911	Tumor necrosis factor
19	9606.ENSP00000233242	0.906	Apolipoprotein B-100
20	9606.ENSP00000431254	0.900	Immunoglobulin lambda like polypeptide 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0001848	0.999	complement binding
GO:0001846	0.999	opsonin binding
GO:0046872	0.998	metal ion binding
GO:0030169	0.996	low-density lipoprotein particle binding
GO:0005102	0.978	signaling receptor binding
GO:0005509	0.896	calcium ion binding
GO:0070325	0.864	lipoprotein particle receptor binding
GO:0050750	0.851	low-density lipoprotein particle receptor binding
GO:0050997	0.840	quaternary ammonium group binding
GO:0097159	0.792	organic cyclic compound binding
GO:0015485	0.777	cholesterol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0050789	0.986	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.926	positive regulation of biological process
GO:0009605	0.907	response to external stimulus
GO:0009987	0.902	cellular process
GO:0019222	0.901	regulation of metabolic process
GO:0006950	0.745	response to stress
GO:0048522	0.737	positive regulation of cellular process
GO:0002376	0.733	immune system process
GO:0051239	0.729	regulation of multicellular organismal process
GO:0031323	0.717	regulation of cellular metabolic process
GO:0048519	0.691	negative regulation of biological process
GO:0006952	0.637	defense response
GO:0009893	0.600	positive regulation of metabolic process
GO:0044419	0.598	biological process involved in interspecies interaction between organisms
GO:0051707	0.578	response to other organism
GO:0048523	0.569	negative regulation of cellular process
GO:0031325	0.517	positive regulation of cellular metabolic process
GO:0060255	0.515	regulation of macromolecule metabolic process
GO:0032501	0.514	multicellular organismal process
GO:0050793	0.503	regulation of developmental process
GO:0051716	0.483	cellular response to stimulus
GO:0048583	0.419	regulation of response to stimulus
GO:0042221	0.350	response to chemical
GO:0051171	0.343	regulation of nitrogen compound metabolic process
GO:0010468	0.339	regulation of gene expression
GO:0006955	0.329	immune response
GO:0006954	0.320	inflammatory response
GO:0032879	0.319	regulation of localization
GO:0002252	0.307	immune effector process
GO:0048584	0.306	positive regulation of response to stimulus
GO:0009617	0.300	response to bacterium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.926	cell periphery
GO:0043227	0.809	membrane-bounded organelle
GO:0031982	0.695	vesicle
GO:0043231	0.535	intracellular membrane-bounded organelle
GO:0016020	0.365	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]