StarFunc result for job id P02743

User Input

>input (223 residues)
MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYS
DLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESS
SGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWD
SVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02743	1.000	1.000	4.136E-46	223	1.000	1.000	P02743.pdb.gz	SAMP_HUMAN Serum amyloid P-component OS=Homo sapiens OX=9606 GN=APCS PE=1 SV=2
2	PDB:2a3wA	0.913	0.998	1.026E-40	204	0.915	1.000	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
3	AFDB:P23680	0.955	0.935	1.478E-36	228	0.717	0.702	P23680.pdb.gz	SAMP_RAT Serum amyloid P-component OS=Rattus norvegicus OX=10116 GN=Apcs PE=2 SV=2
4	AFDB:P02741	0.904	0.900	3.594E-29	224	0.511	0.509	P02741.pdb.gz	CRP_HUMAN C-reactive protein OS=Homo sapiens OX=9606 GN=CRP PE=1 SV=1
5	AFDB:P48199	0.905	0.879	4.493E-27	230	0.453	0.439	P48199.pdb.gz	CRP_RAT C-reactive protein OS=Rattus norvegicus OX=10116 GN=Crp PE=1 SV=1
6	PDB:1b09A	0.883	0.954	1.155E-25	206	0.471	0.510	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
7	AFDB:A3KPH8	0.843	0.836	2.045E-23	225	0.354	0.351	A3KPH8.pdb.gz
8	PDB:4pbpB	0.844	0.894	2.341E-23	210	0.350	0.371	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
9	AFDB:Q7SZ53	0.863	0.866	2.402E-23	222	0.350	0.351	Q7SZ53.pdb.gz	Q7SZ53_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=si:ch211-234p6.13 PE=1 SV=2
10	AFDB:A3KPG5	0.851	0.851	4.572E-23	223	0.341	0.341	A3KPG5.pdb.gz	A3KPG5_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=crp3 PE=1 SV=1
11	AFDB:Q66I62	0.841	0.803	7.410E-23	234	0.363	0.346	Q66I62.pdb.gz
12	AFDB:X4Z0F0	0.853	0.828	2.685E-22	230	0.323	0.313	X4Z0F0.pdb.gz
13	AFDB:Q9PTT2	0.832	0.825	7.442E-22	225	0.341	0.338	Q9PTT2.pdb.gz	JELT_LEPLA Jeltraxin OS=Lepidobatrachus laevis OX=8376 GN=PXN1 PE=1 SV=1
14	PDB:7zl1A	0.767	0.794	1.144E-15	215	0.211	0.219	7zl1A.pdb.gz
15	PDB:7ufgB	0.638	0.135	3.268E-8	1182	0.135	0.025	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:7ufgA	0.560	0.125	1.919E-7	1151	0.148	0.029	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:8a7eC	0.596	0.100	3.297E-6	1524	0.143	0.021	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:3v0aB	0.515	0.117	3.670E-6	1150	0.085	0.017	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:3ffzA	0.514	0.108	5.974E-5	1246	0.139	0.025	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
20	PDB:5n0cA	0.481	0.094	9.176E-5	1293	0.135	0.023	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02743	1.00e-166	460	223	1.000	1.000	SAMP_HUMAN Serum amyloid P-component OS=Homo sapiens OX=9606 GN=APCS PE=1 SV=2
2	P23680	4.70e-116	332	228	0.717	0.702	SAMP_RAT Serum amyloid P-component OS=Rattus norvegicus OX=10116 GN=Apcs PE=2 SV=2
3	P02741	2.08e-77	234	224	0.511	0.509	CRP_HUMAN C-reactive protein OS=Homo sapiens OX=9606 GN=CRP PE=1 SV=1
4	P48199	1.64e-68	211	230	0.457	0.443	CRP_RAT C-reactive protein OS=Rattus norvegicus OX=10116 GN=Crp PE=1 SV=1
5	Q7SZ53	1.65e-41	142	222	0.368	0.369	Q7SZ53_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=si:ch211-234p6.13 PE=1 SV=2
6	Q9PTT2	1.84e-39	137	225	0.332	0.329	JELT_LEPLA Jeltraxin OS=Lepidobatrachus laevis OX=8376 GN=PXN1 PE=1 SV=1
7	Q0IIP8	5.01e-39	136	225	0.377	0.373	CRP_DANRE C-reactive protein OS=Danio rerio OX=7955 GN=crp PE=1 SV=1
8	A3KPG5	5.39e-37	130	223	0.341	0.341	A3KPG5_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=crp3 PE=1 SV=1
9	A3KPH5	3.12e-35	126	225	0.368	0.364	A3KPH5_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=CRP PE=3 SV=1
10	A7E2J1	1.12e-32	119	225	0.359	0.356	A7E2J1_DANRE Pentraxin family member OS=Danio rerio OX=7955 GN=CRP PE=2 SV=1
11	E9QB97	1.22e-17	83.2	530	0.260	0.109	E9QB97_DANRE Carbonic anhydrase OS=Danio rerio OX=7955 GN=ca6 PE=1 SV=1
12	Q6TLW1	1.20e-16	79.7	372	0.220	0.132	Q6TLW1_MOUSE Neuronal pentraxin 1.1 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
13	Q99J85	2.10e-16	79.3	493	0.220	0.099	NPTXR_MOUSE Neuronal pentraxin receptor OS=Mus musculus OX=10090 GN=Nptxr PE=1 SV=1
14	Q6TLW0	2.20e-16	79.3	469	0.220	0.104	Q6TLW0_MOUSE Neuronal pentraxin 1.4 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
15	Q6TKP2	3.20e-16	79.0	672	0.220	0.073	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
16	H3BLN6	3.32e-16	78.6	372	0.233	0.140	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
17	F8VQB8	6.30e-16	78.2	469	0.233	0.111	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
18	P47972	6.89e-16	77.8	431	0.238	0.123	NPTX2_HUMAN Neuronal pentraxin-2 OS=Homo sapiens OX=9606 GN=NPTX2 PE=1 SV=2
19	P97738	8.62e-16	77.4	432	0.233	0.120	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
20	O70340	8.72e-16	77.4	429	0.233	0.121	NPTX2_MOUSE Neuronal pentraxin-2 OS=Mus musculus OX=10090 GN=Nptx2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13385 Laminin_G_3	0.13	23.8	Concanavalin A-like lectin/glucanases superfamily
2	PF00354 Pentaxin	1.1e-91	317.3	Pentaxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255040

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000271450	0.907	Low affinity immunoglobulin gamma Fc region receptor II-a
2	9606.ENSP00000237014	0.764	Transthyretin
3	9606.ENSP00000438248	0.760	Calumenin
4	9606.ENSP00000255030	0.757	C-reactive protein
5	9606.ENSP00000347714	0.694	Immunoglobulin alpha Fc receptor
6	9606.ENSP00000356037	0.673	C4b-binding protein alpha chain
7	9606.ENSP00000363079	0.668	Mannose-binding protein C
8	9606.ENSP00000369862	0.666	Collagen type IV alpha-3-binding protein
9	9606.ENSP00000332194	0.661	Histone H2A type 2-C
10	9606.ENSP00000363827	0.659	Basement membrane-specific heparan sulfate proteoglycan core protein
11	9606.ENSP00000346659	0.645	P protein
12	9606.ENSP00000357113	0.643	Gamma-interferon-inducible protein 16
13	9606.ENSP00000384906	0.628	Serum amyloid A-1 protein
14	9606.ENSP00000415941	0.616	Complement C4-B
15	9606.ENSP00000274764	0.613	Histone H2B type 1-A
16	9606.ENSP00000358151	0.610	Histone H2B type 2-E
17	9606.ENSP00000367022	0.609	Histone H2A type 1-C
18	9606.ENSP00000346839	0.602	Fibronectin type III domain containing
19	9606.ENSP00000289316	0.600	Histone H2B type 1-D
20	9606.ENSP00000296417	0.600	Histone H2A.Z

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0042802	1.000	identical protein binding
GO:0001846	1.000	opsonin binding
GO:0001848	0.979	complement binding
GO:0043167	0.871	ion binding
GO:0046872	0.838	metal ion binding
GO:0097159	0.816	organic cyclic compound binding
GO:0005509	0.816	calcium ion binding
GO:0008289	0.760	lipid binding
GO:0015485	0.736	cholesterol binding
GO:0046790	0.595	virion binding
GO:0051082	0.593	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.991	cellular process
GO:0065007	0.979	biological regulation
GO:0050789	0.972	regulation of biological process
GO:0071840	0.939	cellular component organization or biogenesis
GO:0050794	0.936	regulation of cellular process
GO:0006950	0.924	response to stress
GO:0009605	0.893	response to external stimulus
GO:0006952	0.889	defense response
GO:0044419	0.878	biological process involved in interspecies interaction between organisms
GO:0016043	0.792	cellular component organization
GO:0009607	0.782	response to biotic stimulus
GO:0002376	0.711	immune system process
GO:0019222	0.710	regulation of metabolic process
GO:0048523	0.688	negative regulation of cellular process
GO:0051239	0.671	regulation of multicellular organismal process
GO:0060255	0.649	regulation of macromolecule metabolic process
GO:0051707	0.648	response to other organism
GO:0044085	0.630	cellular component biogenesis
GO:0048583	0.579	regulation of response to stimulus
GO:0006954	0.579	inflammatory response
GO:0098542	0.578	defense response to other organism
GO:0022607	0.527	cellular component assembly
GO:0031323	0.508	regulation of cellular metabolic process
GO:0006955	0.483	immune response
GO:0048518	0.436	positive regulation of biological process
GO:0002682	0.384	regulation of immune system process
GO:0043933	0.376	protein-containing complex organization
GO:0051241	0.364	negative regulation of multicellular organismal process
GO:0065003	0.360	protein-containing complex assembly
GO:0002526	0.333	acute inflammatory response
GO:0032101	0.331	regulation of response to external stimulus
GO:0048585	0.324	negative regulation of response to stimulus
GO:0080134	0.319	regulation of response to stress
GO:0080090	0.318	regulation of primary metabolic process
GO:0032501	0.308	multicellular organismal process
GO:0051171	0.306	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.981	extracellular space
GO:0031982	0.969	vesicle
GO:0070013	0.965	intracellular organelle lumen
GO:0071944	0.964	cell periphery
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0070062	0.956	extracellular exosome
GO:0031012	0.911	extracellular matrix
GO:0072562	0.903	blood microparticle
GO:0005634	0.888	nucleus
GO:0062023	0.865	collagen-containing extracellular matrix
GO:0032991	0.783	protein-containing complex
GO:0005737	0.735	cytoplasm
GO:0012505	0.328	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]