StarFunc result for job id P02746

User Input

>input (253 residues)
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02746	1.000	1.000	1.837E-40	253	1.000	1.000	P02746.pdb.gz	C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3
2	AFDB:P31721	0.630	0.630	6.705E-33	253	0.779	0.779	P31721.pdb.gz	C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus OX=10116 GN=C1qb PE=1 SV=2
3	AFDB:F1NH19	0.571	0.589	6.421E-25	244	0.542	0.561	F1NH19.pdb.gz	F1NH19_CHICK Complement C1q B chain OS=Gallus gallus OX=9031 GN=C1QB PE=1 SV=3
4	AFDB:P02747	0.563	0.576	1.101E-21	245	0.486	0.502	P02747.pdb.gz	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
5	AFDB:Q02105	0.529	0.542	7.184E-21	246	0.435	0.447	Q02105.pdb.gz	C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2
6	AFDB:P02745	0.511	0.525	8.459E-19	245	0.399	0.412	P02745.pdb.gz	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2
7	AFDB:P31720	0.479	0.494	1.994E-18	245	0.375	0.388	P31720.pdb.gz	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
8	AFDB:P98086	0.504	0.519	1.302E-16	245	0.375	0.388	P98086.pdb.gz	C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus OX=10090 GN=C1qa PE=1 SV=2
9	AFDB:A0A158VDR9	0.483	0.493	9.973E-16	247	0.324	0.332	A0A158VDR9.pdb.gz
10	AFDB:A0A0B5JQA2	0.504	0.522	1.375E-15	244	0.375	0.389	A0A0B5JQA2.pdb.gz
11	PDB:5kc6B	0.452	0.759	4.382E-10	144	0.150	0.264	5kc6B.pdb.gz
12	PDB:5h4bA	0.456	0.815	6.376E-10	136	0.162	0.301	5h4bA.pdb.gz
13	PDB:7e57B	0.313	0.597	6.091E-4	123	0.079	0.163	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:4tlgA	0.239	0.164	1.158E-3	396	0.055	0.035	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
15	PDB:5a3oA	0.267	0.518	6.788E-3	114	0.079	0.175	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
16	PDB:1olmE	0.238	0.164	8.874E-3	397	0.055	0.035	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
17	PDB:4fixA	0.217	0.103	9.362E-3	629	0.079	0.032	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:4uybA	0.242	0.163	9.362E-3	401	0.063	0.040	4uybA.pdb.gz
19	PDB:7chjB	0.155	0.168	1.516E-2	226	0.075	0.084	7chjB.pdb.gz	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.
20	PDB:7drtB	0.213	0.129	2.091E-2	496	0.043	0.022	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02746	0.0	511	253	1.000	1.000	C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3
2	P14106	3.39e-125	357	253	0.794	0.794	C1QB_MOUSE Complement C1q subcomponent subunit B OS=Mus musculus OX=10090 GN=C1qb PE=1 SV=2
3	P31721	1.34e-120	345	253	0.779	0.779	C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus OX=10116 GN=C1qb PE=1 SV=2
4	F1NH19	3.26e-82	248	244	0.538	0.557	F1NH19_CHICK Complement C1q B chain OS=Gallus gallus OX=9031 GN=C1QB PE=1 SV=3
5	P02747	3.08e-61	194	245	0.455	0.469	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
6	Q02105	1.25e-60	193	246	0.427	0.439	C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2
7	P31722	2.02e-58	187	245	0.427	0.441	C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus OX=10116 GN=C1qc PE=1 SV=2
8	P31720	9.62e-43	147	245	0.375	0.388	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
9	P02745	2.09e-42	146	245	0.364	0.376	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2
10	P98086	3.78e-37	132	245	0.368	0.380	C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus OX=10090 GN=C1qa PE=1 SV=2
11	Q5XJ71	5.66e-36	129	214	0.364	0.430	Q5XJ71_DANRE C1qc protein OS=Danio rerio OX=7955 GN=zgc:103597 PE=2 SV=1
12	A8K660	5.05e-35	127	244	0.352	0.365	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
13	Q15848	5.05e-35	127	244	0.352	0.365	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
14	Q8K3R4	8.24e-35	127	244	0.368	0.381	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
15	F1QFM5	1.68e-34	126	247	0.316	0.324	F1QFM5_DANRE Complement component 1, q subcomponent, A chain OS=Danio rerio OX=7955 GN=c1qa PE=1 SV=1
16	Q504F7	2.34e-34	125	247	0.316	0.324	Q504F7_DANRE Complement C1q subcomponent subunit A precursor OS=Danio rerio OX=7955 GN=zgc:109903 PE=2 SV=1
17	Q60994	2.96e-34	125	247	0.364	0.372	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
18	Q3Y5Z3	2.09e-33	123	240	0.336	0.354	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
19	Q4ZJM7	5.42e-32	124	482	0.348	0.183	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
20	Q8K479	7.90e-31	116	243	0.340	0.354	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	22	16.4	BclA C-terminal domain
2	PF00386 C1q	3.1e-33	126.1	C1q domain
3	PF01391 Collagen	4.9e-11	53.5	Collagen triple helix repeat (20 copies)
4	PF00229 TNF	3.8e+02	12.4	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363770	0.999	Complement C1q subcomponent subunit C
2	9606.ENSP00000363773	0.999	Complement C1q subcomponent subunit A
3	9606.ENSP00000385035	0.973	Complement C1s subcomponent
4	9606.ENSP00000438615	0.973	Complement C1r subcomponent
5	9606.ENSP00000363869	0.968	V-set and immunoglobulin domain-containing protein 4
6	9606.ENSP00000396688	0.967	Complement C4-A
7	9606.ENSP00000415941	0.967	Complement C4-B
8	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
9	9606.ENSP00000278407	0.940	Plasma protease C1 inhibitor
10	9606.ENSP00000299367	0.935	Complement C2
11	9606.ENSP00000286301	0.927	Macrophage colony-stimulating factor 1 receptor
12	9606.ENSP00000357981	0.915	Cathepsin S
13	9606.ENSP00000262629	0.901	TYRO protein tyrosine kinase-binding protein
14	9606.ENSP00000302079	0.876	C3a anaphylatoxin chemotactic receptor
15	9606.ENSP00000352071	0.871	Scavenger receptor cysteine-rich type 1 protein M130
16	9606.ENSP00000369286	0.864	Lymphocyte antigen 86
17	9606.ENSP00000320866	0.825	Calreticulin
18	9606.ENSP00000478289	0.806	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
19	9606.ENSP00000356399	0.786	Complement factor H
20	9606.ENSP00000380948	0.780	Integrin beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.937	identical protein binding
GO:0005102	0.439	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.982	regulation of biological process
GO:0048518	0.914	positive regulation of biological process
GO:0050778	0.903	positive regulation of immune response
GO:0002376	0.902	immune system process
GO:0002253	0.889	activation of immune response
GO:0006959	0.886	humoral immune response
GO:0002252	0.877	immune effector process
GO:0009987	0.876	cellular process
GO:0006956	0.810	complement activation
GO:0050794	0.772	regulation of cellular process
GO:0002250	0.732	adaptive immune response
GO:0002460	0.707	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0016064	0.690	immunoglobulin mediated immune response
GO:0006958	0.659	complement activation, classical pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.998	cell periphery
GO:0005615	0.989	extracellular space
GO:0032991	0.982	protein-containing complex
GO:0005886	0.940	plasma membrane
GO:0030312	0.874	external encapsulating structure
GO:0031982	0.866	vesicle
GO:0005622	0.770	intracellular anatomical structure
GO:0031012	0.725	extracellular matrix
GO:0062023	0.578	collagen-containing extracellular matrix
GO:0005737	0.576	cytoplasm
GO:0043229	0.528	intracellular organelle
GO:0072562	0.394	blood microparticle
GO:0043231	0.376	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]