StarFunc result for job id P02747

User Input

>input (245 residues)
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS
VFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV
LLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF
LLFPD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02747	1.000	1.000	1.859E-39	245	1.000	1.000	P02747.pdb.gz	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
2	AFDB:P31722	0.574	0.574	1.794E-29	245	0.763	0.763	P31722.pdb.gz	C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus OX=10116 GN=C1qc PE=1 SV=2
3	AFDB:Q02105	0.569	0.567	1.087E-28	246	0.743	0.740	Q02105.pdb.gz	C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2
4	AFDB:P02746	0.581	0.567	1.919E-21	253	0.506	0.490	P02746.pdb.gz	C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3
5	AFDB:F1NH19	0.518	0.520	2.314E-20	244	0.433	0.434	F1NH19.pdb.gz	F1NH19_CHICK Complement C1q B chain OS=Gallus gallus OX=9031 GN=C1QB PE=1 SV=3
6	AFDB:P31721	0.536	0.520	3.180E-20	253	0.469	0.455	P31721.pdb.gz	C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus OX=10116 GN=C1qb PE=1 SV=2
7	AFDB:P14106	0.559	0.542	5.401E-20	253	0.486	0.470	P14106.pdb.gz	C1QB_MOUSE Complement C1q subcomponent subunit B OS=Mus musculus OX=10090 GN=C1qb PE=1 SV=2
8	AFDB:A0A0B5JQA2	0.523	0.525	2.031E-19	244	0.457	0.459	A0A0B5JQA2.pdb.gz
9	AFDB:E1BSP0	0.515	0.519	6.177E-19	243	0.384	0.387	E1BSP0.pdb.gz
10	AFDB:P31720	0.499	0.499	2.591E-16	245	0.376	0.376	P31720.pdb.gz	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
11	PDB:5kc6B	0.475	0.785	1.990E-11	144	0.151	0.257	5kc6B.pdb.gz
12	PDB:5h4bA	0.463	0.801	1.490E-10	136	0.151	0.272	5h4bA.pdb.gz
13	PDB:7e57B	0.273	0.500	6.636E-4	123	0.082	0.163	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:5a3oA	0.275	0.523	1.127E-3	114	0.082	0.175	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
15	PDB:2waaA	0.212	0.170	3.084E-3	335	0.053	0.039	2waaA.pdb.gz
16	PDB:4tlgA	0.225	0.149	3.252E-3	396	0.061	0.038	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
17	PDB:4fixA	0.243	0.110	5.823E-3	629	0.098	0.038	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:4uybA	0.215	0.145	6.826E-3	401	0.057	0.035	4uybA.pdb.gz
19	PDB:1olmE	0.215	0.143	7.589E-3	397	0.057	0.035	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
20	PDB:3cl5A	0.223	0.168	9.381E-3	358	0.073	0.050	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02747	7.65e-177	487	245	1.000	1.000	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
2	P31722	1.88e-110	319	245	0.763	0.763	C1QC_RAT Complement C1q subcomponent subunit C OS=Rattus norvegicus OX=10116 GN=C1qc PE=1 SV=2
3	Q02105	6.50e-106	308	246	0.731	0.728	C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2
4	P02746	2.44e-59	190	253	0.469	0.455	C1QB_HUMAN Complement C1q subcomponent subunit B OS=Homo sapiens OX=9606 GN=C1QB PE=1 SV=3
5	P14106	2.66e-59	189	253	0.416	0.403	C1QB_MOUSE Complement C1q subcomponent subunit B OS=Mus musculus OX=10090 GN=C1qb PE=1 SV=2
6	P31721	3.75e-56	181	253	0.445	0.431	C1QB_RAT Complement C1q subcomponent subunit B OS=Rattus norvegicus OX=10116 GN=C1qb PE=1 SV=2
7	F1NH19	3.00e-54	176	244	0.437	0.439	F1NH19_CHICK Complement C1q B chain OS=Gallus gallus OX=9031 GN=C1QB PE=1 SV=3
8	Q5XJ71	1.26e-53	174	214	0.429	0.491	Q5XJ71_DANRE C1qc protein OS=Danio rerio OX=7955 GN=zgc:103597 PE=2 SV=1
9	A8K660	4.41e-43	148	244	0.424	0.426	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
10	Q15848	4.41e-43	148	244	0.424	0.426	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
11	Q60994	4.09e-41	143	247	0.384	0.381	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
12	Q8K3R4	7.38e-40	139	244	0.376	0.377	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
13	Q3Y5Z3	6.59e-39	137	240	0.371	0.379	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
14	P31720	1.18e-37	134	245	0.376	0.376	C1QA_RAT Complement C1q subcomponent subunit A OS=Rattus norvegicus OX=10116 GN=C1qa PE=1 SV=2
15	D3ZJ76	9.98e-36	131	331	0.404	0.299	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
16	P98086	1.54e-35	128	245	0.363	0.363	C1QA_MOUSE Complement C1q subcomponent subunit A OS=Mus musculus OX=10090 GN=C1qa PE=1 SV=2
17	Q8K479	1.74e-34	125	243	0.371	0.374	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
18	Q9BXJ0	1.84e-33	123	243	0.363	0.366	C1QT5_HUMAN Complement C1q tumor necrosis factor-related protein 5 OS=Homo sapiens OX=9606 GN=C1QTNF5 PE=1 SV=1
19	Q4ZJN1	2.11e-33	125	333	0.380	0.279	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
20	P02745	3.54e-33	122	245	0.384	0.384	C1QA_HUMAN Complement C1q subcomponent subunit A OS=Homo sapiens OX=9606 GN=C1QA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	1.6e+02	13.5	BclA C-terminal domain
2	PF00386 C1q	9.6e-33	124.5	C1q domain
3	PF01391 Collagen	7.5e-11	52.9	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313967	0.999	Complement C1q subcomponent subunit B
2	9606.ENSP00000363773	0.999	Complement C1q subcomponent subunit A
3	9606.ENSP00000438615	0.975	Complement C1r subcomponent
4	9606.ENSP00000385035	0.972	Complement C1s subcomponent
5	9606.ENSP00000396688	0.962	Complement C4-A
6	9606.ENSP00000415941	0.962	Complement C4-B
7	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
8	9606.ENSP00000299367	0.939	Complement C2
9	9606.ENSP00000278407	0.927	Plasma protease C1 inhibitor
10	9606.ENSP00000262629	0.912	TYRO protein tyrosine kinase-binding protein
11	9606.ENSP00000320866	0.883	Calreticulin
12	9606.ENSP00000286301	0.857	Macrophage colony-stimulating factor 1 receptor
13	9606.ENSP00000363869	0.851	V-set and immunoglobulin domain-containing protein 4
14	9606.ENSP00000357981	0.806	Cathepsin S
15	9606.ENSP00000478289	0.800	V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition . Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bou [...]
16	9606.ENSP00000362205	0.772	Triggering receptor expressed on myeloid cells 2
17	9606.ENSP00000352071	0.769	Scavenger receptor cysteine-rich type 1 protein M130
18	9606.ENSP00000411770	0.768	Collectin-11
19	9606.ENSP00000247153	0.758	Properdin
20	9606.ENSP00000302079	0.746	C3a anaphylatoxin chemotactic receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.925	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050789	0.989	regulation of biological process
GO:0048518	0.976	positive regulation of biological process
GO:0048583	0.972	regulation of response to stimulus
GO:0050794	0.969	regulation of cellular process
GO:0002376	0.946	immune system process
GO:0002682	0.917	regulation of immune system process
GO:0002253	0.913	activation of immune response
GO:0006959	0.911	humoral immune response
GO:0009987	0.883	cellular process
GO:0002252	0.875	immune effector process
GO:0006956	0.840	complement activation
GO:0048519	0.791	negative regulation of biological process
GO:0002250	0.787	adaptive immune response
GO:0002460	0.778	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051239	0.768	regulation of multicellular organismal process
GO:0002443	0.760	leukocyte mediated immunity
GO:0019724	0.745	B cell mediated immunity
GO:0048523	0.741	negative regulation of cellular process
GO:0016064	0.716	immunoglobulin mediated immune response
GO:0051241	0.688	negative regulation of multicellular organismal process
GO:0006958	0.676	complement activation, classical pathway
GO:0002683	0.643	negative regulation of immune system process
GO:0050793	0.558	regulation of developmental process
GO:1902105	0.520	regulation of leukocyte differentiation
GO:0045637	0.487	regulation of myeloid cell differentiation
GO:0002761	0.455	regulation of myeloid leukocyte differentiation
GO:0010721	0.447	negative regulation of cell development
GO:1903707	0.384	negative regulation of hemopoiesis
GO:0045638	0.368	negative regulation of myeloid cell differentiation
GO:1902106	0.367	negative regulation of leukocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.997	cell periphery
GO:0005615	0.992	extracellular space
GO:0032991	0.943	protein-containing complex
GO:0005886	0.907	plasma membrane
GO:0031982	0.854	vesicle
GO:0005622	0.774	intracellular anatomical structure
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:0030312	0.720	external encapsulating structure
GO:0005737	0.707	cytoplasm
GO:0031012	0.597	extracellular matrix
GO:0062023	0.563	collagen-containing extracellular matrix
GO:0072562	0.392	blood microparticle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]