StarFunc result for job id P02750

User Input

>input (347 residues)
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDHGSSISCQPPA
EIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV
LDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02750	1.000	1.000	1.038E-61	347	1.000	1.000	P02750.pdb.gz	A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=LRG1 PE=1 SV=2
2	AFDB:Q91XL1	0.895	0.908	7.343E-41	342	0.611	0.620	Q91XL1.pdb.gz	Q91XL1_MOUSE Leucine-rich HEV glycoprotein OS=Mus musculus OX=10090 GN=Lrg1 PE=1 SV=1
3	AFDB:Q8R5M3	0.476	0.302	2.742E-17	578	0.285	0.171	Q8R5M3.pdb.gz	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
4	AFDB:P22792	0.570	0.387	7.220E-17	545	0.323	0.206	P22792.pdb.gz	CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens OX=9606 GN=CPN2 PE=1 SV=3
5	AFDB:Q8BZ81	0.722	0.452	1.202E-16	582	0.251	0.149	Q8BZ81.pdb.gz	LRRT3_MOUSE Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrtm3 PE=2 SV=2
6	AFDB:Q9DBB9	0.567	0.384	2.001E-16	547	0.314	0.199	Q9DBB9.pdb.gz	CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus OX=10090 GN=Cpn2 PE=1 SV=2
7	AFDB:Q8TF66	0.458	0.291	3.165E-16	581	0.294	0.176	Q8TF66.pdb.gz	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
8	AFDB:B8JKM0	0.726	0.499	1.537E-15	524	0.259	0.172	B8JKM0.pdb.gz	B8JKM0_DANRE Leucine-rich repeat transmembrane neuronal 1 OS=Danio rerio OX=7955 GN=lrrtm1 PE=1 SV=1
9	AFDB:O75093	0.426	0.102	2.086E-15	1534	0.271	0.061	O75093.pdb.gz	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
10	AFDB:Q00P20	0.699	0.534	4.962E-15	469	0.239	0.177	Q00P20.pdb.gz	Q00P20_DANRE Nyctalopin OS=Danio rerio OX=7955 GN=nyx PE=2 SV=1
11	PDB:1xcdA	0.594	0.666	7.815E-10	305	0.193	0.220	1xcdA.pdb.gz
12	PDB:3t6qA	0.530	0.337	1.859E-9	601	0.199	0.115	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:7tvfD	0.590	0.405	2.655E-9	515	0.190	0.128	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
14	PDB:7wv3A	0.507	0.301	3.066E-8	668	0.179	0.093	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
15	PDB:3b2dA	0.454	0.296	5.651E-8	601	0.213	0.123	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:5yq5B	0.589	0.662	8.074E-8	306	0.193	0.219	5yq5B.pdb.gz
17	PDB:7wrqA	0.448	0.310	8.074E-8	566	0.245	0.150	7wrqA.pdb.gz
18	PDB:2ft3F	0.594	0.668	1.153E-7	305	0.193	0.220	2ft3F.pdb.gz
19	PDB:6gffI	0.500	0.337	1.214E-7	551	0.225	0.142	6gffI.pdb.gz
20	PDB:6zxdk	0.477	0.395	1.825E-7	430	0.216	0.174	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02750	0.0	690	347	1.000	1.000	A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=LRG1 PE=1 SV=2
2	Q91XL1	4.44e-142	407	342	0.631	0.640	Q91XL1_MOUSE Leucine-rich HEV glycoprotein OS=Mus musculus OX=10090 GN=Lrg1 PE=1 SV=1
3	Q9DBB9	1.90e-29	120	547	0.274	0.174	CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus OX=10090 GN=Cpn2 PE=1 SV=2
4	P22792	2.13e-28	117	545	0.285	0.182	CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens OX=9606 GN=CPN2 PE=1 SV=3
5	A0A287B8C4	2.80e-28	117	760	0.282	0.129	A0A287B8C4_PIG Chondroadherin like OS=Sus scrofa OX=9823 GN=CHADL PE=3 SV=2
6	Q8BZ81	4.05e-26	111	582	0.259	0.155	LRRT3_MOUSE Leucine-rich repeat transmembrane neuronal protein 3 OS=Mus musculus OX=10090 GN=Lrrtm3 PE=2 SV=2
7	Q86VH5	4.84e-26	110	581	0.259	0.155	LRRT3_HUMAN Leucine-rich repeat transmembrane neuronal protein 3 OS=Homo sapiens OX=9606 GN=LRRTM3 PE=2 SV=2
8	Q6P3Y9	1.87e-25	109	559	0.268	0.166	PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus OX=10090 GN=Podnl1 PE=1 SV=3
9	B8JKM0	9.84e-25	107	524	0.254	0.168	B8JKM0_DANRE Leucine-rich repeat transmembrane neuronal 1 OS=Danio rerio OX=7955 GN=lrrtm1 PE=1 SV=1
10	Q8R5M3	5.29e-24	105	578	0.248	0.149	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
11	M9PFH7	6.18e-24	105	751	0.245	0.113	M9PFH7_DROME Tartan, isoform B OS=Drosophila melanogaster OX=7227 GN=trn PE=4 SV=1
12	Q9VU51	7.38e-24	105	737	0.245	0.115	Q9VU51_DROME GH10871p OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
13	O08770	8.30e-24	104	567	0.271	0.166	GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus OX=10116 GN=Gp5 PE=3 SV=1
14	E9Q7T7	9.13e-24	104	748	0.274	0.127	CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus OX=10090 GN=Chadl PE=1 SV=1
15	Q8TF66	1.29e-23	103	581	0.222	0.133	LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens OX=9606 GN=LRRC15 PE=1 SV=2
16	Q24250	3.07e-23	103	733	0.251	0.119	Q24250_DROME Tartan protein OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
17	P07359	6.64e-23	102	652	0.251	0.133	GP1BA_HUMAN Platelet glycoprotein Ib alpha chain OS=Homo sapiens OX=9606 GN=GP1BA PE=1 SV=2
18	O08742	7.54e-23	101	567	0.228	0.139	GPV_MOUSE Platelet glycoprotein V OS=Mus musculus OX=10090 GN=Gp5 PE=1 SV=1
19	A5CKE2	7.79e-23	101	639	0.251	0.136	A5CKE2_HUMAN Platelet glycoprotein Ib alpha (Fragment) OS=Homo sapiens OX=9606 GN=GP1BA PE=1 SV=1
20	Q7SYE5	1.20e-22	99.4	363	0.236	0.226	Q7SYE5_DANRE Chad OS=Danio rerio OX=7955 GN=zgc:63475 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	3.2e+02	13.3	Leucine rich repeat C-terminal domain
2	PF00560 LRR_1	7.3e-07	39.6	Leucine Rich Repeat
3	PF12799 LRR_4	2.7e-17	73.7	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	40	15.7	Leucine Rich repeat
5	PF13855 LRR_8	1.7e-45	163.9	Leucine rich repeat
6	PF14580 LRR_9	0.49	21.4	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302621

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307786	0.965	Cytochrome c
2	9606.ENSP00000362299	0.964	Endoglin
3	9606.ENSP00000387654	0.676	Prenylcysteine oxidase 1
4	9606.ENSP00000346839	0.658	Fibronectin type III domain containing
5	9606.ENSP00000225474	0.641	Granulocyte colony-stimulating factor
6	9606.ENSP00000348170	0.635	Haptoglobin
7	9606.ENSP00000351905	0.622	TGF-beta receptor type-2
8	9606.ENSP00000364133	0.611	TGF-beta receptor type-1
9	9606.ENSP00000416066	0.593	Alpha-1-antitrypsin
10	9606.ENSP00000376793	0.586	Serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
11	9606.ENSP00000450540	0.586	Alpha-1-antichymotrypsin
12	9606.ENSP00000378235	0.579	Scm-like with four MBT domains protein 1
13	9606.ENSP00000385834	0.572	Serotransferrin
14	9606.ENSP00000226355	0.571	Afamin
15	9606.ENSP00000216211	0.563	Uroplakin-3a
16	9606.ENSP00000263100	0.553	Alpha-1B-glycoprotein
17	9606.ENSP00000265983	0.547	Hemopexin
18	9606.ENSP00000259396	0.533	Alpha-1-acid glycoprotein 1
19	9606.ENSP00000381293	0.528	Vesicle-fusing ATPase
20	9606.ENSP00000393887	0.516	Alpha-2-HS-glycoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005160	0.997	transforming growth factor beta receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.986	cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0032501	0.923	multicellular organismal process
GO:0006950	0.892	response to stress
GO:0048583	0.892	regulation of response to stimulus
GO:0090287	0.882	regulation of cellular response to growth factor stimulus
GO:0032502	0.868	developmental process
GO:0051239	0.848	regulation of multicellular organismal process
GO:0090092	0.847	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048856	0.834	anatomical structure development
GO:0048522	0.830	positive regulation of cellular process
GO:0051240	0.775	positive regulation of multicellular organismal process
GO:1901342	0.759	regulation of vasculature development
GO:1904018	0.753	positive regulation of vasculature development
GO:0048584	0.713	positive regulation of response to stimulus
GO:0023056	0.650	positive regulation of signaling
GO:0042127	0.612	regulation of cell population proliferation
GO:0009967	0.610	positive regulation of signal transduction
GO:0042060	0.608	wound healing
GO:0007155	0.597	cell adhesion
GO:0007159	0.528	leukocyte cell-cell adhesion
GO:0090100	0.520	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009653	0.498	anatomical structure morphogenesis
GO:0044319	0.483	wound healing, spreading of cells
GO:0001936	0.450	regulation of endothelial cell proliferation
GO:1903844	0.442	regulation of cellular response to transforming growth factor beta stimulus
GO:0017015	0.424	regulation of transforming growth factor beta receptor signaling pathway
GO:0008284	0.398	positive regulation of cell population proliferation
GO:0048519	0.395	negative regulation of biological process
GO:0045765	0.387	regulation of angiogenesis
GO:0045766	0.360	positive regulation of angiogenesis
GO:0001938	0.352	positive regulation of endothelial cell proliferation
GO:0010837	0.332	regulation of keratinocyte proliferation
GO:0048523	0.324	negative regulation of cellular process
GO:0010631	0.313	epithelial cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.997	membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0012505	0.995	endomembrane system
GO:0031982	0.993	vesicle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005737	0.975	cytoplasm
GO:0031410	0.954	cytoplasmic vesicle
GO:0070062	0.941	extracellular exosome
GO:0030141	0.938	secretory granule
GO:0034774	0.923	secretory granule lumen
GO:0071944	0.740	cell periphery
GO:0016020	0.576	membrane
GO:0072562	0.409	blood microparticle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]