StarFunc result for job id P02751

User Input

>input (2477 residues)
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDT
SEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVT
VGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSR
WCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQ
KEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPI
ECFMPLDVQADREDSRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2CEW3	0.121	0.120	0.000	2500	0.555	0.550	A2CEW3.pdb.gz	A2CEW3_DANRE Fibronectin OS=Danio rerio OX=7955 GN=cb1057 PE=1 SV=2
2	AFDB:B0S602	0.179	0.179	0.000	2480	0.583	0.582	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
3	AFDB:P07589	0.277	0.276	0.000	2478	0.937	0.937	P07589.pdb.gz	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
4	AFDB:P11722	0.297	0.296	0.000	2483	0.815	0.813	P11722.pdb.gz	FINC_CHICK Fibronectin OS=Gallus gallus OX=9031 GN=FN1 PE=2 SV=4
5	AFDB:Q28275	0.214	0.233	0.000	2208	0.832	0.934	Q28275.pdb.gz	FINC_CANLF Fibronectin (Fragment) OS=Canis lupus familiaris OX=9615 GN=FN1 PE=2 SV=3
6	AFDB:A0A0G2K1L0	0.130	0.150	1.296E-66	2019	0.117	0.144	A0A0G2K1L0.pdb.gz	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
7	AFDB:A0A0G2K2W0	0.120	0.127	4.159E-64	2238	0.135	0.150	A0A0G2K2W0.pdb.gz	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
8	AFDB:A0A0R4ITJ9	0.099	0.123	5.435E-60	1892	0.115	0.150	A0A0R4ITJ9.pdb.gz	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
9	AFDB:O97394	0.113	0.122	2.680E-58	2224	0.138	0.154	O97394.pdb.gz	SDK_DROME Protein sidekick OS=Drosophila melanogaster OX=7227 GN=sdk PE=1 SV=2
10	AFDB:Q8AV58	0.096	0.108	2.921E-55	2169	0.127	0.145	Q8AV58.pdb.gz	SDK1_CHICK Protein sidekick-1 OS=Gallus gallus OX=9031 GN=SDK1 PE=1 SV=1
11	PDB:5a42A	0.074	0.101	1.802E-12	1597	0.052	0.081	5a42A.pdb.gz
12	PDB:7q1yA	0.060	0.093	1.785E-11	1374	0.038	0.068	7q1yA.pdb.gz
13	PDB:7q5zA	0.061	0.096	6.484E-10	1344	0.039	0.071	7q5zA.pdb.gz
14	PDB:5oj2B	0.057	0.142	1.340E-9	692	0.039	0.139	5oj2B.pdb.gz
15	PDB:6h03A	0.061	0.103	3.107E-9	1223	0.038	0.078	6h03A.pdb.gz
16	PDB:7vonA	0.059	0.094	5.512E-9	1399	0.035	0.062	7vonA.pdb.gz
17	PDB:8eyyA	0.079	0.197	6.423E-9	775	0.021	0.068	8eyyA.pdb.gz
18	PDB:4ziqA	0.077	0.114	1.433E-8	1450	0.040	0.068	4ziqA.pdb.gz
19	PDB:1e07A	0.068	0.190	1.489E-8	642	0.033	0.128	1e07A.pdb.gz
20	PDB:8dtlA	0.075	0.192	2.021E-8	741	0.020	0.066	8dtlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2CEW3	0.0	2787	2500	0.562	0.557	A2CEW3_DANRE Fibronectin OS=Danio rerio OX=7955 GN=cb1057 PE=1 SV=2
2	B0S602	0.0	2950	2480	0.587	0.587	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
3	F1SS24	0.0	4707	2462	0.931	0.937	F1SS24_PIG Fibronectin OS=Sus scrofa OX=9823 GN=FN1 PE=1 SV=2
4	P02751	0.0	5094	2477	1.000	1.000	FINC_HUMAN Fibronectin OS=Homo sapiens OX=9606 GN=FN1 PE=1 SV=5
5	P04937	0.0	4725	2477	0.921	0.921	FINC_RAT Fibronectin OS=Rattus norvegicus OX=10116 GN=Fn1 PE=1 SV=2
6	P07589	0.0	4752	2478	0.932	0.932	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
7	P11276	0.0	4729	2477	0.920	0.920	FINC_MOUSE Fibronectin OS=Mus musculus OX=10090 GN=Fn1 PE=1 SV=4
8	P11722	0.0	4153	2483	0.813	0.812	FINC_CHICK Fibronectin OS=Gallus gallus OX=9031 GN=FN1 PE=2 SV=4
9	Q28275	0.0	3283	2208	0.675	0.758	FINC_CANLF Fibronectin (Fragment) OS=Canis lupus familiaris OX=9615 GN=FN1 PE=2 SV=3
10	Q3UGY5	0.0	2279	2386	0.481	0.500	Q3UGY5_MOUSE Fibronectin OS=Mus musculus OX=10090 GN=Fn1 PE=2 SV=1
11	Q6JAN2	0.0	2164	2408	0.475	0.488	Q6JAN2_DANRE Fibronectin OS=Danio rerio OX=7955 GN=wu:fb03c02 PE=1 SV=1
12	Q80Z71	1.81e-103	370	1560	0.125	0.198	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
13	P24821	7.16e-97	353	2201	0.124	0.140	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
14	A0A0G2K1L0	1.95e-92	338	2110	0.122	0.144	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2
15	A0A8I6ARC1	1.05e-91	336	2202	0.126	0.142	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
16	Q80YX1	2.71e-91	335	2110	0.122	0.143	TENA_MOUSE Tenascin OS=Mus musculus OX=10090 GN=Tnc PE=1 SV=1
17	Q29116	3.14e-91	333	1746	0.104	0.147	TENA_PIG Tenascin OS=Sus scrofa OX=9823 GN=TNC PE=1 SV=1
18	A0A8I6GHT4	1.01e-90	332	1928	0.115	0.148	A0A8I6GHT4_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
19	F1QYE2	1.40e-88	325	1811	0.097	0.133	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
20	A0A8I6AG89	3.06e-87	321	2019	0.119	0.146	A0A8I6AG89_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17964 Big_10	9.9e+02	11.1	Bacterial Ig domain
2	PF07198 DUF1410	0.5	22.1	Protein of unknown function (DUF1410)
3	PF16258 DUF4912	0.12	24.0	Domain of unknown function (DUF4912)
4	PF16323 DUF4959	0.0013	30.3	Domain of unknown function (DUF4959)
5	PF00039 fn1	1.1e-137	459.2	Fibronectin type I domain
6	PF00040 fn2	2e-31	119.1	Fibronectin type II domain
7	PF00041 fn3	2.2e-260	853.3	Fibronectin type III domain
8	PF13199 Glyco_hydro_66	2.3	18.3	Glycosyl hydrolase family 66
9	PF09294 Interfer-bind	5e-17	73.4	Interferon-alpha/beta receptor, fibronectin type III
10	PF10179 NDNF	3.3e-16	71.0	Neuron-derived neurotrophic factor, first Fn(III) domain
11	PF19433 NDNF_C	2.2e-09	48.5	Neuron-derived Neurotrophic Factor C-terminal
12	PF16656 Pur_ac_phosph_N	2.3e-29	113.2	Purple acid Phosphatase, N-terminal domain
13	PF17217 UPA	27	15.9	UPA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261023	0.999	Integrin alpha-V
2	9606.ENSP00000293379	0.999	Integrin alpha-5
3	9606.ENSP00000361818	0.999	Syndecan-4
4	9606.ENSP00000379350	0.999	Integrin beta-1
5	9606.ENSP00000380227	0.999	Integrin alpha-4
6	9606.ENSP00000452786	0.999	Integrin beta-3
7	9606.ENSP00000260356	0.998	Thrombospondin-1
8	9606.ENSP00000355330	0.998	Protein-glutamine gamma-glutamyltransferase 2
9	9606.ENSP00000398632	0.998	CD44 antigen
10	9606.ENSP00000007722	0.997	Integrin alpha-3
11	9606.ENSP00000256474	0.997	Von Hippel-Lindau disease tumor suppressor
12	9606.ENSP00000262407	0.997	Integrin alpha-IIb
13	9606.ENSP00000370542	0.997	Syndecan-1
14	9606.ENSP00000267257	0.996	Paxillin
15	9606.ENSP00000264741	0.993	Integrin alpha-9
16	9606.ENSP00000356954	0.993	Connective tissue growth factor
17	9606.ENSP00000052754	0.992	Decorin
18	9606.ENSP00000231004	0.992	Protein-lysine 6-oxidase
19	9606.ENSP00000307046	0.992	Syndecan-2
20	9606.ENSP00000308938	0.992	Plasminogen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097718	0.968	disordered domain specific binding
GO:0005102	0.899	signaling receptor binding
GO:0019899	0.793	enzyme binding
GO:0044877	0.765	protein-containing complex binding
GO:0005178	0.659	integrin binding
GO:0005201	0.389	extracellular matrix structural constituent
GO:0002020	0.381	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.984	regulation of biological process
GO:0048869	0.980	cellular developmental process
GO:0050794	0.974	regulation of cellular process
GO:0032501	0.971	multicellular organismal process
GO:0048856	0.967	anatomical structure development
GO:0050896	0.939	response to stimulus
GO:0007155	0.922	cell adhesion
GO:0007275	0.911	multicellular organism development
GO:0048518	0.893	positive regulation of biological process
GO:0031589	0.832	cell-substrate adhesion
GO:0048731	0.832	system development
GO:0048522	0.816	positive regulation of cellular process
GO:0071840	0.805	cellular component organization or biogenesis
GO:0016043	0.796	cellular component organization
GO:0051716	0.775	cellular response to stimulus
GO:0009653	0.764	anatomical structure morphogenesis
GO:0016477	0.733	cell migration
GO:0019222	0.726	regulation of metabolic process
GO:0048513	0.713	animal organ development
GO:0030154	0.709	cell differentiation
GO:0009888	0.699	tissue development
GO:0098609	0.679	cell-cell adhesion
GO:0048583	0.635	regulation of response to stimulus
GO:0007160	0.628	cell-matrix adhesion
GO:0060255	0.611	regulation of macromolecule metabolic process
GO:0048519	0.608	negative regulation of biological process
GO:0007154	0.539	cell communication
GO:0042221	0.522	response to chemical
GO:0023052	0.512	signaling
GO:0048646	0.492	anatomical structure formation involved in morphogenesis
GO:0048523	0.485	negative regulation of cellular process
GO:0009966	0.466	regulation of signal transduction
GO:0008152	0.460	metabolic process
GO:0051171	0.459	regulation of nitrogen compound metabolic process
GO:0051239	0.455	regulation of multicellular organismal process
GO:0031323	0.449	regulation of cellular metabolic process
GO:0071704	0.445	organic substance metabolic process
GO:0007399	0.441	nervous system development
GO:0048584	0.436	positive regulation of response to stimulus
GO:0007165	0.432	signal transduction
GO:0040012	0.430	regulation of locomotion
GO:0080090	0.424	regulation of primary metabolic process
GO:0010468	0.424	regulation of gene expression
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:0009887	0.399	animal organ morphogenesis
GO:0060429	0.398	epithelium development
GO:0044238	0.369	primary metabolic process
GO:0006807	0.326	nitrogen compound metabolic process
GO:0006950	0.320	response to stress
GO:0051173	0.319	positive regulation of nitrogen compound metabolic process
GO:0042127	0.311	regulation of cell population proliferation
GO:0050793	0.309	regulation of developmental process
GO:0009790	0.305	embryo development
GO:0031325	0.300	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0062023	0.990	collagen-containing extracellular matrix
GO:0005576	0.969	extracellular region
GO:0005615	0.879	extracellular space
GO:0016020	0.856	membrane
GO:0043227	0.805	membrane-bounded organelle
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:0005737	0.715	cytoplasm
GO:0005886	0.696	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]