StarFunc result for job id P02760

User Input

>input (352 residues)
MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMES
YVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIF
TMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPC
MGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFI
QLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02760	1.000	1.000	3.271E-69	352	1.000	1.000	P02760.pdb.gz	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
2	AFDB:Q07456	0.789	0.796	2.444E-55	349	0.753	0.759	Q07456.pdb.gz	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
3	AFDB:Q64240	0.796	0.803	4.465E-55	349	0.753	0.759	Q64240.pdb.gz	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
4	AFDB:O97921	0.436	0.774	1.498E-15	194	0.134	0.242	O97921.pdb.gz	PTGDS_HORSE Prostaglandin-H2 D-isomerase OS=Equus caballus OX=9796 GN=PTGDS PE=1 SV=1
5	AFDB:Q8QGV4	0.426	0.799	1.672E-15	184	0.134	0.255	Q8QGV4.pdb.gz
6	AFDB:O09114	0.443	0.805	1.970E-15	189	0.119	0.222	O09114.pdb.gz	PTGDS_MOUSE Prostaglandin-H2 D-isomerase OS=Mus musculus OX=10090 GN=Ptgds PE=1 SV=1
7	AFDB:P22057	0.441	0.804	9.138E-15	189	0.142	0.265	P22057.pdb.gz	PTGDS_RAT Prostaglandin-H2 D-isomerase OS=Rattus norvegicus OX=10116 GN=Ptgds PE=1 SV=2
8	AFDB:P41222	0.438	0.787	9.138E-15	190	0.142	0.263	P41222.pdb.gz	PTGDS_HUMAN Prostaglandin-H2 D-isomerase OS=Homo sapiens OX=9606 GN=PTGDS PE=1 SV=1
9	AFDB:Q6UWW0	0.411	0.762	3.596E-14	184	0.102	0.196	Q6UWW0.pdb.gz	LCN15_HUMAN Lipocalin-15 OS=Homo sapiens OX=9606 GN=LCN15 PE=1 SV=1
10	AFDB:P07360	0.428	0.730	3.798E-14	202	0.139	0.243	P07360.pdb.gz	CO8G_HUMAN Complement component C8 gamma chain OS=Homo sapiens OX=9606 GN=C8G PE=1 SV=3
11	PDB:3o2yA	0.429	0.909	6.857E-13	160	0.114	0.250	3o2yA.pdb.gz
12	PDB:2qosC	0.423	0.832	9.019E-13	173	0.122	0.249	2qosC.pdb.gz	Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
13	PDB:6s8vA	0.428	0.838	9.007E-12	172	0.105	0.215	6s8vA.pdb.gz
14	PDB:5n47A	0.422	0.797	9.514E-12	180	0.119	0.233	5n47A.pdb.gz
15	PDB:4iawA	0.440	0.830	1.322E-11	180	0.116	0.228	4iawA.pdb.gz	Structure-guided engineering of Anticalins with improved binding behavior and biochemical characteristics for application in radio-immuno imaging and/or therapy
16	PDB:6qmuA	0.436	0.809	1.940E-11	184	0.114	0.217	6qmuA.pdb.gz	A Tetrahedral Boronic Acid Diester Formed by an Unnatural Amino Acid in the Ligand Pocket of an Engineered Lipocalin.
17	PDB:6gqzA	0.436	0.853	2.286E-11	174	0.099	0.201	6gqzA.pdb.gz
18	PDB:3s26A	0.418	0.845	2.551E-11	169	0.088	0.183	3s26A.pdb.gz
19	PDB:4qaeB	0.431	0.837	4.177E-11	175	0.108	0.217	4qaeB.pdb.gz	Structure of a hepcidin-binding anticalin in complex with its peptide ligand
20	PDB:5n48A	0.406	0.786	4.177E-11	175	0.111	0.223	5n48A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02760	0.0	734	352	1.000	1.000	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
2	Q07456	0.0	567	349	0.756	0.762	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
3	Q64240	0.0	569	349	0.756	0.762	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
4	P86733	2.77e-23	95.5	126	0.134	0.373	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
5	P84875	2.02e-22	94.4	165	0.131	0.279	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
6	O76840	1.72e-20	95.5	2167	0.134	0.022	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
7	Q8TEU8	1.97e-20	94.7	576	0.142	0.087	WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WFIKKN2 PE=1 SV=1
8	Q1WCN6	3.02e-20	90.1	233	0.131	0.197	Q1WCN6_DANRE Tissue factor pathway inhibitor OS=Danio rerio OX=7955 GN=si:ch211-262k23.2 PE=2 SV=1
9	Q868Z9	6.78e-20	93.6	2898	0.128	0.016	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
10	Q7TQN3	1.56e-19	92.0	571	0.142	0.088	WFKN2_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Mus musculus OX=10090 GN=Wfikkn2 PE=1 SV=2
11	Q9WU03	4.17e-19	87.4	252	0.136	0.190	SPIT2_MOUSE Kunitz-type protease inhibitor 2 OS=Mus musculus OX=10090 GN=Spint2 PE=1 SV=1
12	O43291	4.41e-18	84.7	252	0.136	0.190	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
13	F6QKA3	1.02e-17	83.6	250	0.131	0.184	F6QKA3_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1
14	Q02445	1.29e-17	84.3	302	0.136	0.159	TFPI1_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi PE=2 SV=1
15	Q8QGV5	1.91e-17	81.3	184	0.153	0.293	Q8QGV5_DANRE Lipocalin-type prostaglandin D synthase-like protein OS=Danio rerio OX=7955 GN=ptgds PE=1 SV=1
16	G3V8S0	2.50e-17	82.8	258	0.139	0.190	G3V8S0_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=2
17	P10646	1.03e-16	81.6	304	0.145	0.168	TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1
18	P22057	6.99e-16	77.0	189	0.148	0.275	PTGDS_RAT Prostaglandin-H2 D-isomerase OS=Rattus norvegicus OX=10116 GN=Ptgds PE=1 SV=2
19	Q96NZ8	1.51e-15	79.7	548	0.122	0.078	WFKN1_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WFIKKN1 PE=1 SV=1
20	O54819	1.85e-15	78.2	306	0.128	0.147	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00014 Kunitz_BPTI	1e-29	113.9	Kunitz/Bovine pancreatic trypsin inhibitor domain
2	PF00061 Lipocalin	1.1e-26	105.3	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265132

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393887	0.981	Alpha-2-HS-glycoprotein
2	9606.ENSP00000351190	0.977	Inter-alpha-trypsin inhibitor heavy chain H2
3	9606.ENSP00000336829	0.975	Fibrinogen gamma chain
4	9606.ENSP00000295897	0.967	Serum albumin
5	9606.ENSP00000308541	0.960	Prothrombin
6	9606.ENSP00000306361	0.957	Fibrinogen alpha chain
7	9606.ENSP00000205948	0.956	Beta-2-glycoprotein 1
8	9606.ENSP00000356671	0.944	Antithrombin-III
9	9606.ENSP00000236850	0.939	Apolipoprotein A-I
10	9606.ENSP00000306099	0.937	Fibrinogen beta chain
11	9606.ENSP00000266041	0.922	Inter-alpha-trypsin inhibitor heavy chain H4
12	9606.ENSP00000263408	0.912	Complement component C9
13	9606.ENSP00000451291	0.910	Heterogeneous nuclear ribonucleoproteins C1/C2
14	9606.ENSP00000415769	0.907	Inter-alpha-trypsin inhibitor heavy chain H3
15	9606.ENSP00000227667	0.906	Apolipoprotein C-III
16	9606.ENSP00000273283	0.906	Inter-alpha-trypsin inhibitor heavy chain H1
17	9606.ENSP00000265029	0.891	Fetuin-B
18	9606.ENSP00000243347	0.889	Tumor necrosis factor-inducible gene 6 protein
19	9606.ENSP00000356969	0.886	Apolipoprotein A-II
20	9606.ENSP00000379138	0.885	Alpha-fetoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005515	0.998	protein binding
GO:0003824	0.694	catalytic activity
GO:0042802	0.551	identical protein binding
GO:0097159	0.383	organic cyclic compound binding
GO:0016209	0.313	antioxidant activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0065007	0.985	biological regulation
GO:0050789	0.983	regulation of biological process
GO:0009987	0.978	cellular process
GO:0050794	0.963	regulation of cellular process
GO:0071704	0.954	organic substance metabolic process
GO:0044238	0.926	primary metabolic process
GO:0048519	0.926	negative regulation of biological process
GO:0006807	0.880	nitrogen compound metabolic process
GO:1901564	0.866	organonitrogen compound metabolic process
GO:0043170	0.821	macromolecule metabolic process
GO:0048583	0.786	regulation of response to stimulus
GO:0048523	0.755	negative regulation of cellular process
GO:0019538	0.716	protein metabolic process
GO:0023051	0.596	regulation of signaling
GO:0010646	0.596	regulation of cell communication
GO:0051716	0.575	cellular response to stimulus
GO:0009966	0.574	regulation of signal transduction
GO:0042221	0.541	response to chemical
GO:0048585	0.535	negative regulation of response to stimulus
GO:0080134	0.511	regulation of response to stress
GO:0006950	0.387	response to stress
GO:1902531	0.366	regulation of intracellular signal transduction
GO:0044237	0.351	cellular metabolic process
GO:0048518	0.349	positive regulation of biological process
GO:0032501	0.333	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0005737	0.988	cytoplasm
GO:0071944	0.984	cell periphery
GO:0012505	0.954	endomembrane system
GO:0005886	0.940	plasma membrane
GO:0031982	0.930	vesicle
GO:0043230	0.875	extracellular organelle
GO:1903561	0.866	extracellular vesicle
GO:0070062	0.854	extracellular exosome
GO:0031090	0.851	organelle membrane
GO:0062023	0.783	collagen-containing extracellular matrix
GO:0009986	0.774	cell surface
GO:0005739	0.725	mitochondrion
GO:0072562	0.688	blood microparticle
GO:0070013	0.503	intracellular organelle lumen
GO:0031967	0.340	organelle envelope
GO:0031410	0.332	cytoplasmic vesicle
GO:0005634	0.316	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]