StarFunc result for job id P02776

User Input

>input (101 residues)
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02776	1.000	1.000	6.516E-18	101	1.000	1.000	P02776.pdb.gz	PLF4_HUMAN Platelet factor 4 OS=Homo sapiens OX=9606 GN=PF4 PE=1 SV=2
2	AFDB:P10720	0.623	0.606	5.120E-14	104	0.812	0.788	P10720.pdb.gz	PF4V_HUMAN Platelet factor 4 variant OS=Homo sapiens OX=9606 GN=PF4V1 PE=1 SV=1
3	AFDB:Q9Z126	0.565	0.545	8.581E-13	105	0.713	0.686	Q9Z126.pdb.gz	PLF4_MOUSE Platelet factor 4 OS=Mus musculus OX=10090 GN=Pf4 PE=1 SV=1
4	AFDB:P06765	0.564	0.544	1.044E-11	105	0.723	0.695	P06765.pdb.gz	PLF4_RAT Platelet factor 4 OS=Rattus norvegicus OX=10116 GN=Pf4 PE=1 SV=1
5	PDB:1f9rA	0.588	0.892	6.187E-10	65	0.614	0.954	1f9rA.pdb.gz
6	AFDB:P42830	0.593	0.527	9.253E-10	114	0.406	0.360	P42830.pdb.gz	CXCL5_HUMAN C-X-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CXCL5 PE=1 SV=1
7	AFDB:P80162	0.595	0.529	1.275E-9	114	0.386	0.342	P80162.pdb.gz	CXCL6_HUMAN C-X-C motif chemokine 6 OS=Homo sapiens OX=9606 GN=CXCL6 PE=1 SV=4
8	AFDB:P12850	0.566	0.594	3.126E-9	96	0.347	0.365	P12850.pdb.gz	GROA_MOUSE Growth-regulated alpha protein OS=Mus musculus OX=10090 GN=Cxcl1 PE=1 SV=1
9	AFDB:P19875	0.580	0.549	5.218E-9	107	0.426	0.402	P19875.pdb.gz	CXCL2_HUMAN C-X-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CXCL2 PE=1 SV=1
10	AFDB:P09341	0.578	0.547	5.563E-9	107	0.465	0.439	P09341.pdb.gz	GROA_HUMAN Growth-regulated alpha protein OS=Homo sapiens OX=9606 GN=CXCL1 PE=1 SV=1
11	AFDB:P50228	0.577	0.448	5.932E-9	132	0.416	0.318	P50228.pdb.gz	CXCL5_MOUSE C-X-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Cxcl5 PE=1 SV=2
12	PDB:1pfmA	0.582	0.832	3.502E-8	68	0.604	0.897	1pfmA.pdb.gz
13	PDB:2mgsA	0.554	0.763	3.515E-7	71	0.287	0.408	2mgsA.pdb.gz
14	PDB:1f9pA	0.551	0.678	4.542E-7	81	0.347	0.432	1f9pA.pdb.gz
15	PDB:1qe6D	0.540	0.731	8.620E-7	72	0.218	0.306	1qe6D.pdb.gz
16	PDB:1mgsA	0.554	0.744	1.859E-6	73	0.297	0.411	1mgsA.pdb.gz
17	PDB:1qnkA	0.545	0.772	2.562E-6	69	0.267	0.391	1qnkA.pdb.gz
18	PDB:1o80A	0.538	0.709	4.011E-6	74	0.218	0.297	1o80A.pdb.gz
19	PDB:1mi2A	0.487	0.638	5.203E-5	73	0.317	0.438	1mi2A.pdb.gz
20	PDB:7jnyA	0.515	0.632	2.581E-4	80	0.178	0.225	7jnyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02776	7.08e-69	202	101	1.000	1.000	PLF4_HUMAN Platelet factor 4 OS=Homo sapiens OX=9606 GN=PF4 PE=1 SV=2
2	P10720	1.08e-44	142	104	0.871	0.846	PF4V_HUMAN Platelet factor 4 variant OS=Homo sapiens OX=9606 GN=PF4V1 PE=1 SV=1
3	Q9Z126	4.50e-33	112	105	0.723	0.695	PLF4_MOUSE Platelet factor 4 OS=Mus musculus OX=10090 GN=Pf4 PE=1 SV=1
4	P06765	1.44e-32	111	105	0.723	0.695	PLF4_RAT Platelet factor 4 OS=Rattus norvegicus OX=10116 GN=Pf4 PE=1 SV=1
5	P80221	6.47e-20	79.3	112	0.327	0.295	CXCL6_BOVIN C-X-C motif chemokine 6 OS=Bos taurus OX=9913 GN=CXCL6 PE=1 SV=2
6	P02775	1.41e-19	79.0	128	0.356	0.281	CXCL7_HUMAN Platelet basic protein OS=Homo sapiens OX=9606 GN=PPBP PE=1 SV=3
7	P50228	2.66e-19	78.6	132	0.406	0.311	CXCL5_MOUSE C-X-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Cxcl5 PE=1 SV=2
8	P82535	1.48e-17	72.4	76	0.327	0.434	AMC_RABIT Alveolar macrophage chemotactic factor OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
9	P42830	2.64e-17	72.8	114	0.327	0.289	CXCL5_HUMAN C-X-C motif chemokine 5 OS=Homo sapiens OX=9606 GN=CXCL5 PE=1 SV=1
10	Q6I9S7	2.64e-17	72.8	114	0.327	0.289	Q6I9S7_HUMAN C-X-C motif chemokine OS=Homo sapiens OX=9606 GN=CXCL5 PE=1 SV=1
11	P80162	6.29e-17	72.0	114	0.287	0.254	CXCL6_HUMAN C-X-C motif chemokine 6 OS=Homo sapiens OX=9606 GN=CXCL6 PE=1 SV=4
12	P97885	1.12e-16	71.6	130	0.327	0.254	CXCL5_RAT C-X-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Cxcl5 PE=2 SV=1
13	P09341	1.22e-16	70.9	107	0.307	0.290	GROA_HUMAN Growth-regulated alpha protein OS=Homo sapiens OX=9606 GN=CXCL1 PE=1 SV=1
14	P12850	2.27e-16	70.1	96	0.297	0.312	GROA_MOUSE Growth-regulated alpha protein OS=Mus musculus OX=10090 GN=Cxcl1 PE=1 SV=1
15	P14095	3.66e-16	69.3	96	0.287	0.302	GROA_RAT Growth-regulated alpha protein OS=Rattus norvegicus OX=10116 GN=Cxcl1 PE=1 SV=2
16	P10889	2.00e-15	67.8	100	0.317	0.320	CXCL2_MOUSE C-X-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Cxcl2 PE=1 SV=2
17	Q10746	1.12e-14	65.9	101	0.317	0.317	CXCL3_RAT C-X-C motif chemokine 3 OS=Rattus norvegicus OX=10116 GN=Cxcl3 PE=1 SV=2
18	P19875	7.66e-14	63.9	107	0.277	0.262	CXCL2_HUMAN C-X-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CXCL2 PE=1 SV=1
19	P19876	4.99e-13	61.6	107	0.267	0.252	CXCL3_HUMAN C-X-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CXCL3 PE=1 SV=1
20	P30348	6.59e-13	61.2	100	0.267	0.270	CXCL2_RAT C-X-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Cxcl2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	3.8e-11	54.3	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362795	0.999	C-X-C chemokine receptor type 3
2	9606.ENSP00000474412	0.997	C-C motif chemokine 5
3	9606.ENSP00000354901	0.982	C-X-C motif chemokine 9
4	9606.ENSP00000306884	0.981	C-X-C motif chemokine 11
5	9606.ENSP00000305651	0.980	C-X-C motif chemokine 10
6	9606.ENSP00000379140	0.953	Stromal cell-derived factor 1
7	9606.ENSP00000234071	0.935	Vitamin K-dependent protein C
8	9606.ENSP00000216968	0.932	Endothelial protein C receptor
9	9606.ENSP00000356671	0.907	Antithrombin-III
10	9606.ENSP00000300305	0.905	Runt-related transcription factor 1
11	9606.ENSP00000345083	0.903	Dual specificity mitogen-activated protein kinase kinase 3
12	9606.ENSP00000415151	0.903	Core-binding factor subunit beta
13	9606.ENSP00000468348	0.901	Dual specificity mitogen-activated protein kinase kinase 6
14	9606.ENSP00000262494	0.900	Guanine nucleotide-binding protein G(o) subunit alpha
15	9606.ENSP00000312999	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-2
16	9606.ENSP00000334448	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
17	9606.ENSP00000343027	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-1
18	9606.ENSP00000358867	0.900	Guanine nucleotide-binding protein G(k) subunit alpha
19	9606.ENSP00000478892	0.900	Guanine nucleotide-binding protein G(z) subunit alpha
20	9606.ENSP00000481878	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0008201	0.999	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.994	cellular process
GO:0044419	0.993	biological process involved in interspecies interaction between organisms
GO:0009607	0.993	response to biotic stimulus
GO:0050794	0.987	regulation of cellular process
GO:0002376	0.986	immune system process
GO:0051707	0.982	response to other organism
GO:0006935	0.979	chemotaxis
GO:0006955	0.973	immune response
GO:0006950	0.963	response to stress
GO:0032501	0.953	multicellular organismal process
GO:0007154	0.949	cell communication
GO:0006959	0.946	humoral immune response
GO:0048522	0.940	positive regulation of cellular process
GO:0051716	0.929	cellular response to stimulus
GO:0006952	0.924	defense response
GO:0048519	0.910	negative regulation of biological process
GO:0001775	0.852	cell activation
GO:0007165	0.848	signal transduction
GO:0061844	0.848	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0051239	0.843	regulation of multicellular organismal process
GO:0001906	0.797	cell killing
GO:0002684	0.768	positive regulation of immune system process
GO:0048583	0.756	regulation of response to stimulus
GO:0016477	0.723	cell migration
GO:0050900	0.693	leukocyte migration
GO:0070887	0.689	cellular response to chemical stimulus
GO:0065008	0.616	regulation of biological quality
GO:0048523	0.616	negative regulation of cellular process
GO:0019222	0.557	regulation of metabolic process
GO:0010033	0.555	response to organic substance
GO:0060326	0.515	cell chemotaxis
GO:0009966	0.506	regulation of signal transduction
GO:0060255	0.497	regulation of macromolecule metabolic process
GO:0009893	0.472	positive regulation of metabolic process
GO:0051240	0.471	positive regulation of multicellular organismal process
GO:0050793	0.465	regulation of developmental process
GO:0080090	0.455	regulation of primary metabolic process
GO:0051171	0.454	regulation of nitrogen compound metabolic process
GO:0001562	0.441	response to protozoan
GO:0010604	0.440	positive regulation of macromolecule metabolic process
GO:0031323	0.438	regulation of cellular metabolic process
GO:0048584	0.427	positive regulation of response to stimulus
GO:0032101	0.424	regulation of response to external stimulus
GO:0031640	0.410	killing of cells of another organism
GO:2000026	0.400	regulation of multicellular organismal development
GO:0042832	0.397	defense response to protozoan
GO:0032502	0.384	developmental process
GO:0030595	0.375	leukocyte chemotaxis
GO:0040012	0.369	regulation of locomotion
GO:0050878	0.352	regulation of body fluid levels
GO:0042127	0.352	regulation of cell population proliferation
GO:0010468	0.330	regulation of gene expression
GO:0007186	0.327	G protein-coupled receptor signaling pathway
GO:0071310	0.326	cellular response to organic substance
GO:0048856	0.322	anatomical structure development
GO:0051241	0.302	negative regulation of multicellular organismal process
GO:0030334	0.301	regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.996	cell periphery
GO:0005576	0.996	extracellular region
GO:0043226	0.995	organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005737	0.992	cytoplasm
GO:0070013	0.990	intracellular organelle lumen
GO:0012505	0.979	endomembrane system
GO:0031982	0.962	vesicle
GO:0030141	0.950	secretory granule
GO:0005886	0.939	plasma membrane
GO:0005615	0.905	extracellular space
GO:0031012	0.811	extracellular matrix
GO:0062023	0.783	collagen-containing extracellular matrix
GO:0031091	0.767	platelet alpha granule
GO:0032991	0.578	protein-containing complex
GO:0060205	0.440	cytoplasmic vesicle lumen
GO:0031093	0.400	platelet alpha granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]