StarFunc result for job id P02778

User Input

>input (98 residues)
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P02778	1.000	1.000	5.876E-18	98	1.000	1.000	P02778.pdb.gz	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
2	AFDB:P17515	0.798	0.798	7.409E-14	98	0.684	0.684	P17515.pdb.gz	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
3	AFDB:P48973	0.893	0.893	1.024E-13	98	0.684	0.684	P48973.pdb.gz	CXL10_RAT C-X-C motif chemokine 10 OS=Rattus norvegicus OX=10116 GN=Cxcl10 PE=2 SV=2
4	PDB:1o80A	0.640	0.839	9.361E-12	74	0.724	0.959	1o80A.pdb.gz
5	AFDB:Q07325	0.697	0.551	4.706E-9	125	0.378	0.296	Q07325.pdb.gz	CXCL9_HUMAN C-X-C motif chemokine 9 OS=Homo sapiens OX=9606 GN=CXCL9 PE=1 SV=1
6	AFDB:P18340	0.781	0.624	8.985E-9	126	0.347	0.270	P18340.pdb.gz	CXCL9_MOUSE C-X-C motif chemokine 9 OS=Mus musculus OX=10090 GN=Cxcl9 PE=2 SV=2
7	AFDB:Q8K4B1	0.744	0.597	1.242E-8	125	0.357	0.280	Q8K4B1.pdb.gz	Q8K4B1_RAT C-X-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Cxcl9 PE=2 SV=1
8	AFDB:P30348	0.653	0.641	8.100E-8	100	0.245	0.240	P30348.pdb.gz	CXCL2_RAT C-X-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Cxcl2 PE=1 SV=1
9	AFDB:Q9JHH5	0.617	0.606	9.835E-8	100	0.347	0.340	Q9JHH5.pdb.gz	CXL11_MOUSE C-X-C motif chemokine 11 OS=Mus musculus OX=10090 GN=Cxcl11 PE=3 SV=1
10	AFDB:P10889	0.634	0.622	1.194E-7	100	0.245	0.240	P10889.pdb.gz	CXCL2_MOUSE C-X-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Cxcl2 PE=1 SV=2
11	AFDB:P50228	0.674	0.508	1.650E-7	132	0.296	0.220	P50228.pdb.gz	CXCL5_MOUSE C-X-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Cxcl5 PE=1 SV=2
12	PDB:1qe6D	0.615	0.816	3.636E-6	72	0.173	0.236	1qe6D.pdb.gz
13	PDB:1f9pA	0.577	0.690	1.609E-5	81	0.235	0.284	1f9pA.pdb.gz
14	PDB:2mgsA	0.603	0.807	1.609E-5	71	0.194	0.268	2mgsA.pdb.gz
15	PDB:1f9rA	0.551	0.798	2.700E-5	65	0.214	0.323	1f9rA.pdb.gz
16	PDB:1mgsA	0.578	0.755	8.106E-5	73	0.204	0.274	1mgsA.pdb.gz
17	PDB:7jnyA	0.619	0.744	8.648E-5	80	0.204	0.250	7jnyA.pdb.gz
18	PDB:1qnkA	0.570	0.778	1.050E-4	69	0.194	0.275	1qnkA.pdb.gz
19	PDB:1bo0A	0.498	0.616	3.588E-4	76	0.194	0.250	1bo0A.pdb.gz
20	PDB:5izbA	0.547	0.596	4.356E-4	89	0.153	0.169	5izbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02778	3.92e-65	193	98	1.000	1.000	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
2	P17515	3.47e-42	135	98	0.684	0.684	CXL10_MOUSE C-X-C motif chemokine 10 OS=Mus musculus OX=10090 GN=Cxcl10 PE=1 SV=1
3	P48973	2.67e-37	122	98	0.684	0.684	CXL10_RAT C-X-C motif chemokine 10 OS=Rattus norvegicus OX=10116 GN=Cxcl10 PE=2 SV=2
4	Q8K4B1	7.36e-14	64.3	125	0.337	0.264	Q8K4B1_RAT C-X-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Cxcl9 PE=2 SV=1
5	P18340	2.52e-13	62.8	126	0.327	0.254	CXCL9_MOUSE C-X-C motif chemokine 9 OS=Mus musculus OX=10090 GN=Cxcl9 PE=2 SV=2
6	A0A0R4INB9	9.76e-13	60.5	94	0.347	0.362	CX111_DANRE C-X-C motif chemokine 11-1 OS=Danio rerio OX=7955 GN=cxcl11.1 PE=2 SV=1
7	A2BHJ6	1.50e-11	57.8	102	0.296	0.284	A2BHJ6_DANRE Chemokine (C-X-C motif) ligand 11, duplicate 8 OS=Danio rerio OX=7955 GN=cxc64 PE=3 SV=1
8	B0R191	7.33e-11	56.2	121	0.347	0.281	CX116_DANRE C-X-C motif chemokine 11-6 OS=Danio rerio OX=7955 GN=cxcl11.6 PE=2 SV=1
9	P97885	9.40e-11	56.2	130	0.276	0.208	CXCL5_RAT C-X-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Cxcl5 PE=2 SV=1
10	O14625	1.15e-10	55.1	94	0.296	0.309	CXL11_HUMAN C-X-C motif chemokine 11 OS=Homo sapiens OX=9606 GN=CXCL11 PE=1 SV=1
11	Q07325	1.25e-10	55.8	125	0.296	0.232	CXCL9_HUMAN C-X-C motif chemokine 9 OS=Homo sapiens OX=9606 GN=CXCL9 PE=1 SV=1
12	Q9JHH5	2.02e-09	52.0	100	0.265	0.260	CXL11_MOUSE C-X-C motif chemokine 11 OS=Mus musculus OX=10090 GN=Cxcl11 PE=3 SV=1
13	P50228	2.05e-09	52.8	132	0.276	0.205	CXCL5_MOUSE C-X-C motif chemokine 5 OS=Mus musculus OX=10090 GN=Cxcl5 PE=1 SV=2
14	Q7TNL0	5.38e-09	51.2	100	0.255	0.250	Q7TNL0_RAT C-X-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Cxcl11 PE=2 SV=1
15	A3DTN6	6.26e-09	50.8	103	0.235	0.223	A3DTN6_CHICK Multifunctional fusion protein OS=Gallus gallus OX=9031 GN=IL8 PE=2 SV=2
16	P08317	6.26e-09	50.8	103	0.235	0.223	IL8_CHICK Interleukin-8 OS=Gallus gallus OX=9031 GN=CXCL8 PE=2 SV=1
17	P80162	8.02e-09	50.8	114	0.235	0.202	CXCL6_HUMAN C-X-C motif chemokine 6 OS=Homo sapiens OX=9606 GN=CXCL6 PE=1 SV=4
18	A0A0R4IQ43	9.71e-09	50.4	106	0.316	0.292	A0A0R4IQ43_DANRE C-X-C motif chemokine 11-6-like OS=Danio rerio OX=7955 GN=cxcl11.5 PE=3 SV=1
19	P82535	1.52e-07	46.6	76	0.255	0.329	AMC_RABIT Alveolar macrophage chemotactic factor OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
20	A0A0G2KYH9	2.34e-07	46.6	98	0.286	0.286	A0A0G2KYH9_DANRE Chemokine (C-X-C motif) ligand 8a OS=Danio rerio OX=7955 GN=cxcl8a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	3.2e-14	64.2	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009846

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000001309	0.995	Chemokine (C-X-C motif) receptor 3
2	61853.ENSNLEP00000009808	0.984	Chemokine (C-X-C motif) ligand 11
3	61853.ENSNLEP00000009839	0.984	Chemokine (C-X-C motif) ligand 9
4	61853.ENSNLEP00000009974	0.962	Chemokine (C-X-C motif) ligand 13
5	61853.ENSNLEP00000009660	0.950	C-X-C motif chemokine
6	61853.ENSNLEP00000009664	0.950	C-X-C motif chemokine
7	61853.ENSNLEP00000001763	0.908	Chemokine (C-C motif) ligand 11
8	61853.ENSNLEP00000007411	0.905	Chemokine (C-C motif) receptor 1
9	61853.ENSNLEP00000017204	0.887	Chemokine (C-C motif) ligand 5
10	61853.ENSNLEP00000020374	0.887	Interleukin 6
11	61853.ENSNLEP00000007418	0.885	Chemokine (C-C motif) receptor 3
12	61853.ENSNLEP00000000929	0.879	Interleukin 10
13	61853.ENSNLEP00000016023	0.877	Chemokine (C-C motif) receptor 2
14	61853.ENSNLEP00000003454	0.876	Chemokine (C-C motif) ligand 22
15	61853.ENSNLEP00000007426	0.875	Belongs to the tumor necrosis factor family.
16	61853.ENSNLEP00000002277	0.873	Multifunctional fusion protein
17	61853.ENSNLEP00000015334	0.873	Colony stimulating factor 2 (granulocyte-macrophage)
18	61853.ENSNLEP00000001727	0.872	Chemokine (C-C motif) ligand 2
19	61853.ENSNLEP00000008993	0.868	Chemokine (C-X-C motif) receptor 5
20	61853.ENSNLEP00000010812	0.864	C-X-C motif chemokine receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0097367	0.998	carbohydrate derivative binding
GO:0005539	0.994	glycosaminoglycan binding
GO:0042056	0.993	chemoattractant activity
GO:1901681	0.992	sulfur compound binding
GO:0008603	0.991	cAMP-dependent protein kinase regulator activity
GO:0008201	0.888	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.993	positive regulation of biological process
GO:0048583	0.992	regulation of response to stimulus
GO:0009615	0.991	response to virus
GO:0006950	0.990	response to stress
GO:0009987	0.986	cellular process
GO:0042221	0.983	response to chemical
GO:0048522	0.983	positive regulation of cellular process
GO:0032101	0.981	regulation of response to external stimulus
GO:0040012	0.976	regulation of locomotion
GO:0050920	0.969	regulation of chemotaxis
GO:0051716	0.962	cellular response to stimulus
GO:0002684	0.962	positive regulation of immune system process
GO:0032103	0.961	positive regulation of response to external stimulus
GO:0006955	0.957	immune response
GO:0048519	0.953	negative regulation of biological process
GO:0006952	0.951	defense response
GO:0050921	0.950	positive regulation of chemotaxis
GO:0010033	0.940	response to organic substance
GO:0007165	0.915	signal transduction
GO:0050793	0.914	regulation of developmental process
GO:0098542	0.913	defense response to other organism
GO:0030335	0.907	positive regulation of cell migration
GO:0071310	0.903	cellular response to organic substance
GO:0009617	0.903	response to bacterium
GO:0051239	0.899	regulation of multicellular organismal process
GO:0042127	0.878	regulation of cell population proliferation
GO:0002685	0.871	regulation of leukocyte migration
GO:0032501	0.866	multicellular organismal process
GO:0071345	0.845	cellular response to cytokine stimulus
GO:0002687	0.816	positive regulation of leukocyte migration
GO:0008284	0.796	positive regulation of cell population proliferation
GO:0019222	0.783	regulation of metabolic process
GO:0051241	0.780	negative regulation of multicellular organismal process
GO:0002688	0.766	regulation of leukocyte chemotaxis
GO:0002237	0.759	response to molecule of bacterial origin
GO:0140546	0.757	defense response to symbiont
GO:0051050	0.753	positive regulation of transport
GO:1901700	0.742	response to oxygen-containing compound
GO:0048523	0.742	negative regulation of cellular process
GO:0060255	0.715	regulation of macromolecule metabolic process
GO:0002690	0.715	positive regulation of leukocyte chemotaxis
GO:0032496	0.701	response to lipopolysaccharide
GO:0051607	0.675	defense response to virus
GO:0040011	0.662	locomotion
GO:2000026	0.638	regulation of multicellular organismal development
GO:0051093	0.613	negative regulation of developmental process
GO:0007166	0.602	cell surface receptor signaling pathway
GO:0071675	0.601	regulation of mononuclear cell migration
GO:0051282	0.587	regulation of sequestering of calcium ion
GO:0009893	0.575	positive regulation of metabolic process
GO:0051924	0.574	regulation of calcium ion transport
GO:0045765	0.566	regulation of angiogenesis
GO:0006954	0.558	inflammatory response
GO:0051928	0.551	positive regulation of calcium ion transport
GO:0071677	0.551	positive regulation of mononuclear cell migration
GO:2000403	0.506	positive regulation of lymphocyte migration
GO:0010468	0.483	regulation of gene expression
GO:0006935	0.483	chemotaxis
GO:0010604	0.483	positive regulation of macromolecule metabolic process
GO:1990868	0.476	response to chemokine
GO:0051279	0.476	regulation of release of sequestered calcium ion into cytosol
GO:0016525	0.476	negative regulation of angiogenesis
GO:0080090	0.467	regulation of primary metabolic process
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0034764	0.466	positive regulation of transmembrane transport
GO:0031323	0.454	regulation of cellular metabolic process
GO:0050900	0.443	leukocyte migration
GO:1904427	0.437	positive regulation of calcium ion transmembrane transport
GO:0051240	0.421	positive regulation of multicellular organismal process
GO:0031325	0.379	positive regulation of cellular metabolic process
GO:0006959	0.371	humoral immune response
GO:0032502	0.370	developmental process
GO:0051173	0.363	positive regulation of nitrogen compound metabolic process
GO:0048856	0.359	anatomical structure development
GO:0060326	0.351	cell chemotaxis
GO:0001906	0.326	cell killing
GO:0023051	0.316	regulation of signaling
GO:0010646	0.316	regulation of cell communication
GO:0009966	0.307	regulation of signal transduction
GO:0009889	0.305	regulation of biosynthetic process
GO:0019219	0.304	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.302	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.918	cell periphery
GO:0016020	0.864	membrane
GO:0005886	0.802	plasma membrane
GO:0005615	0.739	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]