StarFunc result for job id P02786

User Input

>input (760 residues)
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAAR
RLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7zqsB	0.834	0.991	0.000	639	0.841	1.000	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
2	AFDB:P02786	1.000	1.000	0.000	760	1.000	1.000	P02786.pdb.gz	TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2
3	AFDB:Q07891	0.857	0.860	0.000	757	0.784	0.787	Q07891.pdb.gz	TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus OX=10029 GN=TFRC PE=2 SV=1
4	AFDB:Q62351	0.845	0.842	0.000	763	0.772	0.769	Q62351.pdb.gz	TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus OX=10090 GN=Tfrc PE=1 SV=1
5	AFDB:F1NTM6	0.826	0.809	2.732E-91	776	0.532	0.521	F1NTM6.pdb.gz
6	AFDB:B3DHD1	0.814	0.804	8.288E-84	770	0.433	0.427	B3DHD1.pdb.gz
7	AFDB:Q9UP52	0.828	0.786	2.046E-80	801	0.433	0.411	Q9UP52.pdb.gz	TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens OX=9606 GN=TFR2 PE=1 SV=1
8	AFDB:B2GUY2	0.824	0.786	8.207E-79	798	0.437	0.416	B2GUY2.pdb.gz	TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus OX=10116 GN=Tfr2 PE=2 SV=1
9	AFDB:E7F131	0.815	0.793	9.116E-78	782	0.401	0.390	E7F131.pdb.gz
10	AFDB:A0A0G2KE94	0.823	0.799	4.769E-75	783	0.387	0.375	A0A0G2KE94.pdb.gz
11	AFDB:O54697	0.762	0.777	8.261E-55	745	0.253	0.258	O54697.pdb.gz	NALDL_RAT Aminopeptidase NAALADL1 OS=Rattus norvegicus OX=10116 GN=Naaladl1 PE=1 SV=1
12	PDB:4tweA	0.747	0.801	1.885E-52	706	0.234	0.252	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
13	PDB:6etyA	0.742	0.806	2.097E-52	696	0.232	0.253	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
14	PDB:3fedA	0.740	0.812	3.050E-52	690	0.236	0.259	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
15	PDB:7w72A	0.179	0.225	1.636E-7	588	0.076	0.099	7w72A.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
16	PDB:4f9vA	0.214	0.472	1.917E-6	307	0.064	0.160	4f9vA.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
17	PDB:7d21A	0.282	0.594	3.453E-6	328	0.086	0.198	7d21A.pdb.gz	A Unique Carboxylic-Acid Hydrogen-Bond Network (CAHBN) Confers Glutaminyl Cyclase Activity on M28 Family Enzymes.
18	PDB:6yi1A	0.232	0.502	1.464E-5	329	0.053	0.122	6yi1A.pdb.gz	Hydrazides Are Potent Transition-State Analogues for Glutaminyl Cyclase Implicated in the Pathogenesis of Alzheimer's Disease.
19	PDB:4faiB	0.204	0.475	7.289E-5	305	0.051	0.128	4faiB.pdb.gz	Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
20	PDB:4ksiA	0.122	0.170	1.539E-3	517	0.029	0.043	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GUY2	0.0	590	798	0.430	0.410	TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus OX=10116 GN=Tfr2 PE=2 SV=1
2	P02786	0.0	1581	760	1.000	1.000	TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2
3	Q07891	0.0	1252	757	0.788	0.791	TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus OX=10029 GN=TFRC PE=2 SV=1
4	Q32PQ5	0.0	557	771	0.420	0.414	Q32PQ5_DANRE Transferrin receptor protein 1 OS=Danio rerio OX=7955 GN=tfr1b PE=1 SV=1
5	Q5MPX4	0.0	595	770	0.446	0.440	Q5MPX4_DANRE Transferrin receptor protein 1 OS=Danio rerio OX=7955 GN=tfr1a PE=1 SV=1
6	Q62351	0.0	1237	763	0.772	0.769	TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus OX=10090 GN=Tfrc PE=1 SV=1
7	Q90997	0.0	733	776	0.532	0.521	TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus OX=9031 GN=TFRC PE=2 SV=2
8	Q99376	0.0	1245	761	0.764	0.763	TFR1_RAT Transferrin receptor protein 1 OS=Rattus norvegicus OX=10116 GN=Tfrc PE=1 SV=2
9	Q9JKX3	0.0	588	798	0.428	0.407	TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus OX=10090 GN=Tfr2 PE=1 SV=2
10	Q9UP52	0.0	570	801	0.428	0.406	TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens OX=9606 GN=TFR2 PE=1 SV=1
11	Q5MPX2	2.76e-178	531	783	0.405	0.393	Q5MPX2_DANRE Transferrin receptor 2 OS=Danio rerio OX=7955 GN=zgc:123043 PE=2 SV=1
12	Q9CZR2	4.14e-67	238	740	0.261	0.268	NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus OX=10090 GN=Naalad2 PE=1 SV=2
13	O35409	1.40e-65	234	752	0.254	0.257	FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Folh1 PE=1 SV=2
14	Q04609	8.59e-64	229	750	0.242	0.245	FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=FOLH1 PE=1 SV=1
15	P70627	1.20e-62	226	752	0.266	0.269	FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus OX=10116 GN=Folh1 PE=1 SV=1
16	Q9Y3Q0	1.15e-60	220	740	0.257	0.264	NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens OX=9606 GN=NAALAD2 PE=1 SV=1
17	O54697	1.49e-58	214	745	0.245	0.250	NALDL_RAT Aminopeptidase NAALADL1 OS=Rattus norvegicus OX=10116 GN=Naaladl1 PE=1 SV=1
18	Q9UQQ1	5.08e-58	213	740	0.239	0.246	NALDL_HUMAN Aminopeptidase NAALADL1 OS=Homo sapiens OX=9606 GN=NAALADL1 PE=1 SV=2
19	Q7Y228	6.62e-47	179	681	0.229	0.256	LAMP1_ARATH Probable glutamate carboxypeptidase LAMP1 OS=Arabidopsis thaliana OX=3702 GN=LAMP1 PE=2 SV=1
20	A0A1D6L709	1.44e-45	176	713	0.179	0.191	VP8_MAIZE Probable glutamate carboxypeptidase VP8 OS=Zea mays OX=4577 GN=VP8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12967 DUF3855	2.8e+02	12.8	Domain of Unknown Function with PDB structure (DUF3855)
2	PF02225 PA	1.9e-07	42.4	PA domain
3	PF04389 Peptidase_M28	1e-08	46.7	Peptidase family M28
4	PF04253 TFR_dimer	5e-08	44.4	Transferrin receptor-like dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385834	0.999	Serotransferrin
2	9606.ENSP00000417404	0.999	Hereditary hemochromatosis protein
3	9606.ENSP00000452780	0.999	Beta-2-microglobulin
4	9606.ENSP00000273550	0.989	Ferritin heavy chain
5	9606.ENSP00000216044	0.988	GTP-binding protein 1
6	9606.ENSP00000432083	0.973	Heat shock cognate 71 kDa protein
7	9606.ENSP00000378364	0.936	Natural resistance-associated macrophage protein 2
8	9606.ENSP00000337014	0.933	Hemojuvelin
9	9606.ENSP00000368831	0.929	Sorting nexin-2
10	9606.ENSP00000256637	0.927	Sortilin
11	9606.ENSP00000300935	0.926	Ras-related protein Rab-8A
12	9606.ENSP00000306866	0.924	Gamma-aminobutyric acid receptor-associated protein
13	9606.ENSP00000366998	0.924	Sorting nexin-5
14	9606.ENSP00000255194	0.923	AP-3 complex subunit beta-1
15	9606.ENSP00000250244	0.917	AP-1 complex subunit mu-2
16	9606.ENSP00000261842	0.916	AP-4 complex subunit epsilon-1
17	9606.ENSP00000309477	0.914	Cytoplasmic aconitate hydratase
18	9606.ENSP00000225719	0.912	M14 carboxypeptidases
19	9606.ENSP00000325369	0.911	AP-3 complex subunit sigma-1
20	9606.ENSP00000357674	0.911	SNARE-associated protein Snapin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004998	0.999	transferrin receptor activity
GO:0042802	0.788	identical protein binding
GO:0003824	0.778	catalytic activity
GO:0019899	0.734	enzyme binding
GO:0097159	0.687	organic cyclic compound binding
GO:1901363	0.671	heterocyclic compound binding
GO:0003676	0.593	nucleic acid binding
GO:0046983	0.583	protein dimerization activity
GO:0042803	0.553	protein homodimerization activity
GO:0044877	0.551	protein-containing complex binding
GO:0003725	0.541	double-stranded RNA binding
GO:0019900	0.510	kinase binding
GO:0019901	0.483	protein kinase binding
GO:0140096	0.358	catalytic activity, acting on a protein
GO:0016787	0.348	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.987	cellular process
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.973	positive regulation of cellular process
GO:0042592	0.960	homeostatic process
GO:0002682	0.959	regulation of immune system process
GO:0050865	0.955	regulation of cell activation
GO:0051249	0.950	regulation of lymphocyte activation
GO:0055072	0.946	iron ion homeostasis
GO:0002684	0.942	positive regulation of immune system process
GO:0050864	0.937	regulation of B cell activation
GO:0070663	0.929	regulation of leukocyte proliferation
GO:0051251	0.928	positive regulation of lymphocyte activation
GO:0030155	0.919	regulation of cell adhesion
GO:0008284	0.916	positive regulation of cell population proliferation
GO:0022407	0.912	regulation of cell-cell adhesion
GO:0032944	0.902	regulation of mononuclear cell proliferation
GO:1903037	0.885	regulation of leukocyte cell-cell adhesion
GO:0019725	0.863	cellular homeostasis
GO:0010039	0.854	response to iron ion
GO:0045785	0.852	positive regulation of cell adhesion
GO:0050670	0.839	regulation of lymphocyte proliferation
GO:0051716	0.833	cellular response to stimulus
GO:0022409	0.832	positive regulation of cell-cell adhesion
GO:0050871	0.826	positive regulation of B cell activation
GO:0070665	0.815	positive regulation of leukocyte proliferation
GO:0050671	0.813	positive regulation of lymphocyte proliferation
GO:0019222	0.799	regulation of metabolic process
GO:0030888	0.787	regulation of B cell proliferation
GO:0006879	0.781	intracellular iron ion homeostasis
GO:0010468	0.758	regulation of gene expression
GO:0006950	0.717	response to stress
GO:0007154	0.700	cell communication
GO:0048583	0.694	regulation of response to stimulus
GO:0009893	0.692	positive regulation of metabolic process
GO:0009605	0.689	response to external stimulus
GO:0010604	0.684	positive regulation of macromolecule metabolic process
GO:1903039	0.673	positive regulation of leukocyte cell-cell adhesion
GO:0048584	0.671	positive regulation of response to stimulus
GO:0050863	0.661	regulation of T cell activation
GO:0070887	0.596	cellular response to chemical stimulus
GO:0050870	0.593	positive regulation of T cell activation
GO:0051179	0.555	localization
GO:0042129	0.540	regulation of T cell proliferation
GO:0042102	0.517	positive regulation of T cell proliferation
GO:0008152	0.513	metabolic process
GO:0048519	0.474	negative regulation of biological process
GO:0031323	0.470	regulation of cellular metabolic process
GO:0051171	0.459	regulation of nitrogen compound metabolic process
GO:0030890	0.458	positive regulation of B cell proliferation
GO:0080090	0.441	regulation of primary metabolic process
GO:0006810	0.437	transport
GO:0071704	0.426	organic substance metabolic process
GO:0048523	0.418	negative regulation of cellular process
GO:0023052	0.412	signaling
GO:0032502	0.398	developmental process
GO:0048856	0.370	anatomical structure development
GO:0051641	0.331	cellular localization
GO:0044237	0.330	cellular metabolic process
GO:0023051	0.327	regulation of signaling
GO:0010646	0.320	regulation of cell communication
GO:0044238	0.319	primary metabolic process
GO:0051246	0.314	regulation of protein metabolic process
GO:0032879	0.307	regulation of localization
GO:0032501	0.300	multicellular organismal process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005768	0.997	endosome
GO:0005576	0.990	extracellular region
GO:0032991	0.980	protein-containing complex
GO:0055037	0.974	recycling endosome
GO:0005615	0.967	extracellular space
GO:1903561	0.959	extracellular vesicle
GO:0009986	0.953	cell surface
GO:0031090	0.934	organelle membrane
GO:0098588	0.890	bounding membrane of organelle
GO:0030659	0.883	cytoplasmic vesicle membrane
GO:0070062	0.808	extracellular exosome
GO:0098796	0.798	membrane protein complex
GO:0098797	0.727	plasma membrane protein complex
GO:0043235	0.720	receptor complex
GO:0098552	0.698	side of membrane
GO:0048471	0.685	perinuclear region of cytoplasm
GO:0098590	0.682	plasma membrane region
GO:0005634	0.611	nucleus
GO:0010008	0.527	endosome membrane
GO:0098802	0.507	plasma membrane signaling receptor complex
GO:0009897	0.452	external side of plasma membrane
GO:0030139	0.381	endocytic vesicle
GO:0030135	0.380	coated vesicle
GO:0030662	0.374	coated vesicle membrane
GO:0005769	0.371	early endosome
GO:0045334	0.369	clathrin-coated endocytic vesicle
GO:0005905	0.338	clathrin-coated pit
GO:0030665	0.334	clathrin-coated vesicle membrane
GO:0005764	0.329	lysosome
GO:0030666	0.327	endocytic vesicle membrane
GO:0070013	0.326	intracellular organelle lumen
GO:0030669	0.304	clathrin-coated endocytic vesicle membrane
GO:0005794	0.301	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.348	Hydrolases.

[back to server]