StarFunc result for job id P02787

User Input

>input (698 residues)
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV
KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPC
ADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD
QYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE
FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKP
VKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK
CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWN
IPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAF
RCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR
APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKL
HDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4h0wA	0.843	0.865	0.000	679	0.971	0.999	4h0wA.pdb.gz	Iron and bismuth bound human serum transferrin reveals a partially-opened conformation in the N-lobe.
2	AFDB:P02787	1.000	1.000	0.000	698	1.000	1.000	P02787.pdb.gz	TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4
3	AFDB:P12346	0.963	0.963	0.000	698	0.729	0.729	P12346.pdb.gz	TRFE_RAT Serotransferrin OS=Rattus norvegicus OX=10116 GN=Tf PE=1 SV=3
4	AFDB:Q921I1	0.961	0.962	0.000	697	0.731	0.732	Q921I1.pdb.gz	TRFE_MOUSE Serotransferrin OS=Mus musculus OX=10090 GN=Tf PE=1 SV=1
5	AFDB:P02788	0.909	0.894	6.339E-103	710	0.615	0.604	P02788.pdb.gz	TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6
6	AFDB:P24627	0.900	0.888	1.606E-101	708	0.603	0.595	P24627.pdb.gz	TRFL_BOVIN Lactotransferrin OS=Bos taurus OX=9913 GN=LTF PE=1 SV=2
7	AFDB:K9IMD0	0.903	0.891	2.804E-101	708	0.599	0.590	K9IMD0.pdb.gz	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
8	AFDB:Q9DBD0	0.939	0.936	4.069E-100	700	0.603	0.601	Q9DBD0.pdb.gz	ICA_MOUSE Inhibitor of carbonic anhydrase OS=Mus musculus OX=10090 GN=Inhca PE=1 SV=1
9	AFDB:P08071	0.912	0.901	6.485E-98	707	0.566	0.559	P08071.pdb.gz	TRFL_MOUSE Lactotransferrin OS=Mus musculus OX=10090 GN=Ltf PE=1 SV=4
10	PDB:2bjjX	0.890	0.897	6.867E-98	692	0.600	0.605	2bjjX.pdb.gz	The Protein Structure of Recombinant Human Lactoferrin Produced in the Milk of Transgenic Cows Closely Matches the Structure of Human Milk-Derived Lactoferrin
11	PDB:1blfA	0.834	0.849	4.744E-96	685	0.592	0.603	1blfA.pdb.gz	Three-dimensional structure of diferric bovine lactoferrin at 2.8 A resolution.
12	AFDB:P02789	0.911	0.903	2.439E-90	705	0.509	0.504	P02789.pdb.gz	TRFE_CHICK Ovotransferrin OS=Gallus gallus OX=9031 PE=1 SV=2
13	PDB:3mc2A	0.921	0.952	2.030E-89	675	0.585	0.604	3mc2A.pdb.gz
14	PDB:3s9mC	0.726	0.976	2.405E-86	517	0.735	0.992	3s9mC.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
15	AFDB:Q9PT13	0.822	0.830	1.215E-79	691	0.470	0.475	Q9PT13.pdb.gz	Q9PT13_ONCMY Serotransferrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
16	PDB:3s9mD	0.686	0.977	6.248E-77	488	0.695	0.994	3s9mD.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
17	PDB:1aivA	0.695	0.705	7.847E-71	686	0.501	0.510	1aivA.pdb.gz
18	PDB:3s9nD	0.636	0.964	8.487E-66	457	0.645	0.985	3s9nD.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
19	PDB:2x26A	0.224	0.448	3.654E-6	308	0.047	0.107	2x26A.pdb.gz
20	PDB:4eswA	0.228	0.419	1.944E-5	342	0.042	0.085	4eswA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZAL5	0.0	816	666	0.582	0.610	B7ZAL5_HUMAN cDNA, FLJ79229, highly similar to Lactotransferrin OS=Homo sapiens OX=9606 PE=2 SV=1
2	K9IMD0	0.0	837	708	0.596	0.588	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
3	P02787	0.0	1449	698	0.999	0.999	TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4
4	P02788	0.0	849	710	0.609	0.599	TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6
5	P02789	0.0	676	705	0.521	0.516	TRFE_CHICK Ovotransferrin OS=Gallus gallus OX=9031 PE=1 SV=2
6	P08071	0.0	780	707	0.572	0.564	TRFL_MOUSE Lactotransferrin OS=Mus musculus OX=10090 GN=Ltf PE=1 SV=4
7	P12346	0.0	1032	698	0.731	0.731	TRFE_RAT Serotransferrin OS=Rattus norvegicus OX=10116 GN=Tf PE=1 SV=3
8	P24627	0.0	840	708	0.600	0.592	TRFL_BOVIN Lactotransferrin OS=Bos taurus OX=9913 GN=LTF PE=1 SV=2
9	Q06AH7	0.0	1445	698	0.996	0.996	Q06AH7_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=2 SV=1
10	Q921I1	0.0	1028	697	0.732	0.733	TRFE_MOUSE Serotransferrin OS=Mus musculus OX=10090 GN=Tf PE=1 SV=1
11	Q9DBD0	0.0	851	700	0.603	0.601	ICA_MOUSE Inhibitor of carbonic anhydrase OS=Mus musculus OX=10090 GN=Inhca PE=1 SV=1
12	Q9PT13	0.0	590	691	0.479	0.483	Q9PT13_ONCMY Serotransferrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	B8JL43	1.81e-158	475	673	0.421	0.437	B8JL43_DANRE Serotransferrin OS=Danio rerio OX=7955 GN=cb285 PE=1 SV=1
14	P08582	3.24e-152	461	738	0.430	0.407	TRFM_HUMAN Melanotransferrin OS=Homo sapiens OX=9606 GN=MELTF PE=1 SV=2
15	Q6P3G0	1.15e-126	387	520	0.340	0.456	Q6P3G0_DANRE Transferrin-a OS=Danio rerio OX=7955 GN=tfa PE=2 SV=2
16	A0PJA6	4.80e-124	368	180	0.249	0.967	A0PJA6_HUMAN TF protein (Fragment) OS=Homo sapiens OX=9606 GN=TF PE=2 SV=1
17	Q9VTZ5	6.27e-49	186	819	0.202	0.172	TRFM_DROME Transferrin 2 OS=Drosophila melanogaster OX=7227 GN=Tsf2 PE=1 SV=1
18	Q0VIL3	3.03e-48	176	371	0.173	0.326	OTOMP_DANRE Otolith matrix protein 1 OS=Danio rerio OX=7955 GN=otomp PE=2 SV=1
19	Q9VWV6	1.39e-23	108	641	0.176	0.192	Q9VWV6_DROME Transferrin OS=Drosophila melanogaster OX=7227 GN=Tsf1 PE=1 SV=1
20	O97355	1.78e-23	107	641	0.176	0.192	O97355_DROME Transferrin OS=Drosophila melanogaster OX=7227 GN=Tsf1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12974 Phosphonate-bd	4e-08	44.7	ABC transporter, phosphonate, periplasmic substrate-binding protein
2	PF00497 SBP_bac_3	30	15.5	Bacterial extracellular solute-binding proteins, family 3
3	PF00405 Transferrin	4.6e-264	885.6	Transferrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385834

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353224	0.999	Transferrin receptor protein 1
2	9606.ENSP00000236850	0.976	Apolipoprotein A-I
3	9606.ENSP00000220478	0.903	Member of the granin protein family that regulates the biogenesis of secretory granules . Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (By similarity). May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway
4	9606.ENSP00000409667	0.902	Synaptojanin-1
5	9606.ENSP00000420525	0.889	Transferrin receptor protein 2
6	9606.ENSP00000393887	0.879	Alpha-2-HS-glycoprotein
7	9606.ENSP00000265132	0.846	Protein AMBP
8	9606.ENSP00000295897	0.836	Serum albumin
9	9606.ENSP00000356969	0.832	Apolipoprotein A-II
10	9606.ENSP00000348170	0.801	Haptoglobin
11	9606.ENSP00000417404	0.799	Hereditary hemochromatosis protein
12	9606.ENSP00000452780	0.780	Beta-2-microglobulin
13	9606.ENSP00000337014	0.770	Hemojuvelin
14	9606.ENSP00000484532	0.766	Protein MIS12 homolog
15	9606.ENSP00000329033	0.745	Mitochondrial glutamate carrier 2
16	9606.ENSP00000351190	0.740	Inter-alpha-trypsin inhibitor heavy chain H2
17	9606.ENSP00000156626	0.739	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
18	9606.ENSP00000265983	0.728	Hemopexin
19	9606.ENSP00000416066	0.726	Alpha-1-antitrypsin
20	9606.ENSP00000332247	0.713	V-type proton ATPase 116 kDa subunit a isoform 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005506	1.000	iron ion binding
GO:0005102	0.871	signaling receptor binding
GO:0140104	0.580	molecular carrier activity
GO:0016530	0.557	metallochaperone activity
GO:0008198	0.466	ferrous iron binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0048522	0.885	positive regulation of cellular process
GO:0032501	0.872	multicellular organismal process
GO:0055082	0.860	intracellular chemical homeostasis
GO:0051179	0.849	localization
GO:0006810	0.843	transport
GO:0098771	0.834	inorganic ion homeostasis
GO:0055080	0.797	monoatomic cation homeostasis
GO:0051716	0.794	cellular response to stimulus
GO:0009605	0.789	response to external stimulus
GO:0044419	0.787	biological process involved in interspecies interaction between organisms
GO:0009607	0.779	response to biotic stimulus
GO:0055072	0.777	iron ion homeostasis
GO:0051707	0.770	response to other organism
GO:0019222	0.753	regulation of metabolic process
GO:0009893	0.733	positive regulation of metabolic process
GO:0042221	0.726	response to chemical
GO:0060255	0.714	regulation of macromolecule metabolic process
GO:0080090	0.700	regulation of primary metabolic process
GO:0051171	0.677	regulation of nitrogen compound metabolic process
GO:0051239	0.670	regulation of multicellular organismal process
GO:0065008	0.665	regulation of biological quality
GO:0032879	0.650	regulation of localization
GO:0060249	0.644	anatomical structure homeostasis
GO:0009617	0.632	response to bacterium
GO:0048519	0.612	negative regulation of biological process
GO:0006811	0.601	monoatomic ion transport
GO:0070887	0.600	cellular response to chemical stimulus
GO:0006812	0.501	monoatomic cation transport
GO:0008152	0.447	metabolic process
GO:0051049	0.444	regulation of transport
GO:0010038	0.440	response to metal ion
GO:0071704	0.427	organic substance metabolic process
GO:0071840	0.390	cellular component organization or biogenesis
GO:0051128	0.370	regulation of cellular component organization
GO:0044238	0.367	primary metabolic process
GO:0016043	0.359	cellular component organization
GO:0048583	0.318	regulation of response to stimulus
GO:0048523	0.318	negative regulation of cellular process
GO:0051240	0.317	positive regulation of multicellular organismal process
GO:0006826	0.307	iron ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.996	endomembrane system
GO:0005622	0.996	intracellular anatomical structure
GO:0005737	0.980	cytoplasm
GO:0071944	0.976	cell periphery
GO:0005576	0.973	extracellular region
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005886	0.964	plasma membrane
GO:0031982	0.953	vesicle
GO:0005615	0.939	extracellular space
GO:0070062	0.905	extracellular exosome
GO:0031410	0.835	cytoplasmic vesicle
GO:0030139	0.614	endocytic vesicle
GO:0031090	0.529	organelle membrane
GO:0005768	0.517	endosome
GO:0031012	0.468	extracellular matrix
GO:0070013	0.454	intracellular organelle lumen
GO:0030666	0.428	endocytic vesicle membrane
GO:0030141	0.427	secretory granule
GO:0032991	0.392	protein-containing complex
GO:0060205	0.383	cytoplasmic vesicle lumen
GO:0005769	0.301	early endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]