StarFunc result for job id P02788

User Input

>input (710 residues)
MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS
PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG
GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA
DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE
AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR
RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT
AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS
NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL
LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1blfA	0.932	0.966	0.000	685	0.676	0.701	1blfA.pdb.gz	Three-dimensional structure of diferric bovine lactoferrin at 2.8 A resolution.
2	PDB:2bjjX	0.970	0.995	0.000	692	0.969	0.994	2bjjX.pdb.gz	The Protein Structure of Recombinant Human Lactoferrin Produced in the Milk of Transgenic Cows Closely Matches the Structure of Human Milk-Derived Lactoferrin
3	AFDB:K9IMD0	0.970	0.972	0.000	708	0.704	0.706	K9IMD0.pdb.gz	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
4	AFDB:P02788	1.000	1.000	0.000	710	1.000	1.000	P02788.pdb.gz	TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6
5	AFDB:P08071	0.969	0.973	0.000	707	0.701	0.704	P08071.pdb.gz	TRFL_MOUSE Lactotransferrin OS=Mus musculus OX=10090 GN=Ltf PE=1 SV=4
6	AFDB:P24627	0.970	0.973	0.000	708	0.689	0.691	P24627.pdb.gz	TRFL_BOVIN Lactotransferrin OS=Bos taurus OX=9913 GN=LTF PE=1 SV=2
7	AFDB:P02787	0.895	0.909	1.284E-100	698	0.604	0.615	P02787.pdb.gz	TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4
8	AFDB:Q9DBD0	0.925	0.938	1.219E-96	700	0.568	0.576	Q9DBD0.pdb.gz	ICA_MOUSE Inhibitor of carbonic anhydrase OS=Mus musculus OX=10090 GN=Inhca PE=1 SV=1
9	AFDB:Q921I1	0.871	0.887	1.435E-96	697	0.575	0.585	Q921I1.pdb.gz	TRFE_MOUSE Serotransferrin OS=Mus musculus OX=10090 GN=Tf PE=1 SV=1
10	AFDB:P12346	0.871	0.885	2.761E-96	698	0.579	0.589	P12346.pdb.gz	TRFE_RAT Serotransferrin OS=Rattus norvegicus OX=10116 GN=Tf PE=1 SV=3
11	PDB:4h0wA	0.768	0.799	1.080E-92	679	0.590	0.617	4h0wA.pdb.gz	Iron and bismuth bound human serum transferrin reveals a partially-opened conformation in the N-lobe.
12	AFDB:P02789	0.903	0.909	1.840E-90	705	0.513	0.516	P02789.pdb.gz	TRFE_CHICK Ovotransferrin OS=Gallus gallus OX=9031 PE=1 SV=2
13	PDB:3mc2A	0.885	0.929	2.930E-85	675	0.549	0.578	3mc2A.pdb.gz
14	AFDB:Q9PT13	0.758	0.777	5.004E-79	691	0.456	0.469	Q9PT13.pdb.gz	Q9PT13_ONCMY Serotransferrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	PDB:1aivA	0.675	0.695	7.160E-70	686	0.503	0.520	1aivA.pdb.gz
16	PDB:3s9mC	0.663	0.900	5.263E-59	517	0.437	0.600	3s9mC.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
17	PDB:3s9mD	0.628	0.900	1.489E-50	488	0.413	0.600	3s9mD.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
18	PDB:3s9nD	0.589	0.897	2.875E-42	457	0.377	0.586	3s9nD.pdb.gz	How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
19	PDB:2x26A	0.207	0.421	9.202E-6	308	0.042	0.097	2x26A.pdb.gz
20	PDB:4h67C	0.225	0.421	9.717E-6	338	0.051	0.107	4h67C.pdb.gz	The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZAL5	0.0	1376	666	0.935	0.997	B7ZAL5_HUMAN cDNA, FLJ79229, highly similar to Lactotransferrin OS=Homo sapiens OX=9606 PE=2 SV=1
2	K9IMD0	0.0	1060	708	0.701	0.703	TRLF_DESRO Lactotransferrin OS=Desmodus rotundus OX=9430 GN=LTF PE=1 SV=1
3	P02787	0.0	856	698	0.606	0.616	TRFE_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=4
4	P02788	0.0	1469	710	1.000	1.000	TRFL_HUMAN Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF PE=1 SV=6
5	P02789	0.0	690	705	0.524	0.528	TRFE_CHICK Ovotransferrin OS=Gallus gallus OX=9031 PE=1 SV=2
6	P08071	0.0	1043	707	0.706	0.709	TRFL_MOUSE Lactotransferrin OS=Mus musculus OX=10090 GN=Ltf PE=1 SV=4
7	P12346	0.0	808	698	0.570	0.580	TRFE_RAT Serotransferrin OS=Rattus norvegicus OX=10116 GN=Tf PE=1 SV=3
8	P24627	0.0	1034	708	0.679	0.681	TRFL_BOVIN Lactotransferrin OS=Bos taurus OX=9913 GN=LTF PE=1 SV=2
9	Q06AH7	0.0	856	698	0.606	0.616	Q06AH7_HUMAN Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=2 SV=1
10	Q921I1	0.0	803	697	0.568	0.578	TRFE_MOUSE Serotransferrin OS=Mus musculus OX=10090 GN=Tf PE=1 SV=1
11	Q9DBD0	0.0	798	700	0.554	0.561	ICA_MOUSE Inhibitor of carbonic anhydrase OS=Mus musculus OX=10090 GN=Inhca PE=1 SV=1
12	Q9PT13	0.0	583	691	0.466	0.479	Q9PT13_ONCMY Serotransferrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	B8JL43	8.38e-158	473	673	0.393	0.415	B8JL43_DANRE Serotransferrin OS=Danio rerio OX=7955 GN=cb285 PE=1 SV=1
14	P08582	7.70e-154	465	738	0.411	0.396	TRFM_HUMAN Melanotransferrin OS=Homo sapiens OX=9606 GN=MELTF PE=1 SV=2
15	Q6P3G0	1.23e-121	375	520	0.310	0.423	Q6P3G0_DANRE Transferrin-a OS=Danio rerio OX=7955 GN=tfa PE=2 SV=2
16	A0PJA6	6.56e-73	236	180	0.158	0.622	A0PJA6_HUMAN TF protein (Fragment) OS=Homo sapiens OX=9606 GN=TF PE=2 SV=1
17	Q0VIL3	8.94e-52	186	371	0.180	0.345	OTOMP_DANRE Otolith matrix protein 1 OS=Danio rerio OX=7955 GN=otomp PE=2 SV=1
18	Q9VTZ5	6.65e-49	186	819	0.173	0.150	TRFM_DROME Transferrin 2 OS=Drosophila melanogaster OX=7227 GN=Tsf2 PE=1 SV=1
19	O97355	1.35e-19	95.9	641	0.221	0.245	O97355_DROME Transferrin OS=Drosophila melanogaster OX=7227 GN=Tsf1 PE=2 SV=1
20	Q9VWV6	1.47e-19	95.5	641	0.221	0.245	Q9VWV6_DROME Transferrin OS=Drosophila melanogaster OX=7227 GN=Tsf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15960 DUF4763	3.7e+02	11.8	Domain of unknown function (DUF4763)
2	PF12974 Phosphonate-bd	1.6e-05	36.2	ABC transporter, phosphonate, periplasmic substrate-binding protein
3	PF00405 Transferrin	5.3e-262	878.9	Transferrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315130	0.984	Clusterin
2	9606.ENSP00000424176	0.893	EPPIN-WFDC6 readthrough
3	9606.ENSP00000361867	0.889	Semenogelin-1
4	9606.ENSP00000261267	0.874	Lysozyme C
5	9606.ENSP00000361746	0.840	Eppin
6	9606.ENSP00000362924	0.696	Gelsolin
7	9606.ENSP00000466090	0.692	Neutrophil elastase
8	9606.ENSP00000421725	0.685	Vitamin D-binding protein
9	9606.ENSP00000237014	0.671	Transthyretin
10	9606.ENSP00000295897	0.669	Serum albumin
11	9606.ENSP00000362108	0.667	Neutrophil gelatinase-associated lipocalin
12	9606.ENSP00000236850	0.665	Apolipoprotein A-I
13	9606.ENSP00000353224	0.660	Transferrin receptor protein 1
14	9606.ENSP00000452780	0.656	Beta-2-microglobulin
15	9606.ENSP00000363458	0.646	Low density lipoprotein receptor adapter protein 1
16	9606.ENSP00000257264	0.643	Transcobalamin-1
17	9606.ENSP00000263598	0.635	Lipocalin-1
18	9606.ENSP00000297435	0.633	Neutrophil defensin 4
19	9606.ENSP00000156626	0.630	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
20	9606.ENSP00000265132	0.628	Protein AMBP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004857	0.999	enzyme inhibitor activity
GO:0005506	0.999	iron ion binding
GO:1901681	0.949	sulfur compound binding
GO:0061134	0.946	peptidase regulator activity
GO:0004866	0.915	endopeptidase inhibitor activity
GO:0004869	0.891	cysteine-type endopeptidase inhibitor activity
GO:0003824	0.869	catalytic activity
GO:0016787	0.759	hydrolase activity
GO:0005102	0.670	signaling receptor binding
GO:0008233	0.407	peptidase activity
GO:0005539	0.326	glycosaminoglycan binding
GO:0008201	0.318	heparin binding
GO:0008289	0.315	lipid binding
GO:0004175	0.309	endopeptidase activity
GO:0008236	0.309	serine-type peptidase activity
GO:0030295	0.308	protein kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0009617	0.975	response to bacterium
GO:0009987	0.971	cellular process
GO:0051239	0.969	regulation of multicellular organismal process
GO:0048518	0.968	positive regulation of biological process
GO:0048519	0.961	negative regulation of biological process
GO:0019222	0.909	regulation of metabolic process
GO:0030162	0.904	regulation of proteolysis
GO:0048522	0.900	positive regulation of cellular process
GO:0006959	0.874	humoral immune response
GO:0019730	0.852	antimicrobial humoral response
GO:0048583	0.849	regulation of response to stimulus
GO:0001817	0.837	regulation of cytokine production
GO:0051336	0.809	regulation of hydrolase activity
GO:1903555	0.784	regulation of tumor necrosis factor superfamily cytokine production
GO:0048584	0.780	positive regulation of response to stimulus
GO:0051248	0.776	negative regulation of protein metabolic process
GO:0044092	0.761	negative regulation of molecular function
GO:0032102	0.747	negative regulation of response to external stimulus
GO:0052547	0.742	regulation of peptidase activity
GO:0032501	0.737	multicellular organismal process
GO:0043086	0.730	negative regulation of catalytic activity
GO:0048523	0.717	negative regulation of cellular process
GO:0002682	0.701	regulation of immune system process
GO:0051346	0.694	negative regulation of hydrolase activity
GO:0051241	0.690	negative regulation of multicellular organismal process
GO:0052548	0.689	regulation of endopeptidase activity
GO:0009893	0.688	positive regulation of metabolic process
GO:0042127	0.678	regulation of cell population proliferation
GO:0010466	0.674	negative regulation of peptidase activity
GO:0010604	0.672	positive regulation of macromolecule metabolic process
GO:0051240	0.652	positive regulation of multicellular organismal process
GO:0080134	0.641	regulation of response to stress
GO:0065008	0.580	regulation of biological quality
GO:0042742	0.547	defense response to bacterium
GO:0031323	0.542	regulation of cellular metabolic process
GO:0051094	0.508	positive regulation of developmental process
GO:0071704	0.429	organic substance metabolic process
GO:0045595	0.423	regulation of cell differentiation
GO:0042221	0.422	response to chemical
GO:0051173	0.412	positive regulation of nitrogen compound metabolic process
GO:0051179	0.407	localization
GO:0051716	0.406	cellular response to stimulus
GO:0009966	0.370	regulation of signal transduction
GO:0051174	0.356	regulation of phosphorus metabolic process
GO:0051247	0.339	positive regulation of protein metabolic process
GO:0019731	0.326	antibacterial humoral response
GO:2000026	0.312	regulation of multicellular organismal development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.995	intracellular anatomical structure
GO:0043231	0.975	intracellular membrane-bounded organelle
GO:0005576	0.973	extracellular region
GO:0005615	0.938	extracellular space
GO:0005634	0.928	nucleus
GO:0005737	0.925	cytoplasm
GO:0012505	0.895	endomembrane system
GO:0070062	0.893	extracellular exosome
GO:0070013	0.740	intracellular organelle lumen
GO:0071944	0.726	cell periphery
GO:0016020	0.628	membrane
GO:0031410	0.614	cytoplasmic vesicle
GO:0034774	0.504	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.759	Hydrolases.
EC:3.4.-.-	0.407	Acting on peptide bonds (peptidases).

[back to server]