StarFunc result for job id P03372

User Input

>input (595 residues)
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P06211	0.755	0.749	2.250E-69	600	0.887	0.880	P06211.pdb.gz	ESR1_RAT Estrogen receptor OS=Rattus norvegicus OX=10116 GN=Esr1 PE=1 SV=1
2	AFDB:Q7ZU32	0.467	0.495	1.031E-38	553	0.429	0.461	Q7ZU32.pdb.gz	Q7ZU32_DANRE Esr2a protein OS=Danio rerio OX=7955 GN=ER[b]2 PE=2 SV=1
3	AFDB:B8JJL4	0.416	0.414	4.468E-38	600	0.432	0.428	B8JJL4.pdb.gz
4	AFDB:Q5RJ38	0.448	0.583	1.218E-25	444	0.274	0.367	Q5RJ38.pdb.gz	Q5RJ38_DANRE Estrogen-related receptor gamma b OS=Danio rerio OX=7955 GN=errb/g PE=3 SV=2
5	AFDB:Q6RKQ3	0.362	0.323	1.302E-19	669	0.227	0.202	Q6RKQ3.pdb.gz	Q6RKQ3_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=2 SV=1
6	AFDB:Q9GLW0	0.370	0.237	2.155E-19	939	0.230	0.146	Q9GLW0.pdb.gz	PRGR_CANLF Progesterone receptor OS=Canis lupus familiaris OX=9615 GN=PGR PE=2 SV=1
7	AFDB:D0EWS6	0.368	0.239	2.256E-19	934	0.237	0.151	D0EWS6.pdb.gz	D0EWS6_PIG Progesterone receptor OS=Sus scrofa OX=9823 GN=PGR PE=2 SV=1
8	AFDB:P06536	0.367	0.278	4.093E-19	795	0.220	0.165	P06536.pdb.gz	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
9	AFDB:F5GXF0	0.341	0.314	9.336E-19	652	0.245	0.224	F5GXF0.pdb.gz	F5GXF0_HUMAN Nuclear receptor subfamily 4 group A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
10	AFDB:P06401	0.368	0.237	1.773E-18	933	0.227	0.145	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
11	PDB:3dzyA	0.374	0.668	2.173E-15	302	0.173	0.341	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.322	0.755	9.611E-9	238	0.092	0.231	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:7kw7F	0.309	0.677	1.520E-8	259	0.099	0.228	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
14	PDB:1g2nA	0.310	0.705	3.466E-8	246	0.097	0.236	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
15	PDB:1is2A	0.096	0.092	6.719E-2	637	0.054	0.050	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
16	PDB:7tynR	0.116	0.153	1.533E-1	373	0.059	0.094	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
17	PDB:5k3hB	0.104	0.100	4.012E-1	635	0.055	0.052	5k3hB.pdb.gz
18	PDB:4wjwB	0.108	0.101	4.603E-1	673	0.047	0.042	4wjwB.pdb.gz	Distinct N-terminal regions of the exomer secretory vesicle cargo Chs3 regulate its trafficking itinerary.
19	PDB:7p5cA	0.073	0.102	5.281E-1	392	0.044	0.066	7p5cA.pdb.gz
20	PDB:2jcdA	0.084	0.124	5.528E-1	315	0.061	0.114	2jcdA.pdb.gz	Structure and Action of the N-Oxygenase Aurf from Streptomyces Thioluteus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5L8C9	0.0	979	589	0.780	0.788	E5L8C9_CHICK Estrogen receptor OS=Gallus gallus OX=9031 PE=2 SV=1
2	G4XH65	0.0	1241	595	1.000	1.000	G4XH65_HUMAN Estrogen receptor OS=Homo sapiens OX=9606 GN=ESR1 PE=2 SV=1
3	H0ZLY1	0.0	974	621	0.775	0.742	H0ZLY1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=3 SV=2
4	P03372	0.0	1241	595	1.000	1.000	ESR1_HUMAN Estrogen receptor OS=Homo sapiens OX=9606 GN=ESR1 PE=1 SV=2
5	P06211	0.0	1064	600	0.889	0.882	ESR1_RAT Estrogen receptor OS=Rattus norvegicus OX=10116 GN=Esr1 PE=1 SV=1
6	P06212	0.0	977	589	0.778	0.786	ESR1_CHICK Estrogen receptor OS=Gallus gallus OX=9031 GN=ESR1 PE=2 SV=1
7	P19785	0.0	1092	599	0.896	0.890	ESR1_MOUSE Estrogen receptor OS=Mus musculus OX=10090 GN=Esr1 PE=1 SV=1
8	P49884	0.0	1146	596	0.919	0.918	ESR1_BOVIN Estrogen receptor OS=Bos taurus OX=9913 GN=ESR1 PE=1 SV=3
9	Q14267	0.0	540	336	0.427	0.756	Q14267_HUMAN Estrogen receptor OS=Homo sapiens OX=9606 PE=2 SV=1
10	Q800Q2	0.0	529	570	0.469	0.489	Q800Q2_ZOAVI Estrogen receptor OS=Zoarces viviparus OX=48416 GN=ERalpha PE=2 SV=1
11	Q8AYH0	0.0	976	589	0.776	0.784	Q8AYH0_COTJA Estrogen receptor OS=Coturnix japonica OX=93934 GN=ESR1 PE=2 SV=1
12	Q91250	0.0	969	587	0.770	0.780	ESR1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=2 SV=1
13	Q9YHZ7	8.74e-178	518	617	0.454	0.438	ESR1_ICTPU Estrogen receptor OS=Ictalurus punctatus OX=7998 GN=esr1 PE=2 SV=2
14	P16058	2.65e-177	517	622	0.474	0.453	ESR1_ONCMY Estrogen receptor OS=Oncorhynchus mykiss OX=8022 GN=esr1 PE=2 SV=3
15	A0A060X747	7.47e-175	509	577	0.469	0.484	A0A060X747_ONCMY Estrogen receptor OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00015227001 PE=3 SV=1
16	P57717	8.10e-170	496	569	0.455	0.476	ESR1_DANRE Estrogen receptor OS=Danio rerio OX=7955 GN=esr1 PE=2 SV=2
17	P57782	1.51e-162	478	568	0.408	0.428	ESR2_ONCMY Estrogen receptor beta OS=Oncorhynchus mykiss OX=8022 GN=esr2 PE=2 SV=1
18	Q62986	1.04e-161	474	530	0.452	0.508	ESR2_RAT Estrogen receptor beta OS=Rattus norvegicus OX=10116 GN=Esr2 PE=1 SV=2
19	O08537	1.95e-161	473	530	0.450	0.506	ESR2_MOUSE Estrogen receptor beta OS=Mus musculus OX=10090 GN=Esr2 PE=1 SV=3
20	Q7LCB3	3.33e-161	473	530	0.437	0.491	Q7LCB3_HUMAN Estrogen receptor beta OS=Homo sapiens OX=9606 GN=NR3A2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12743 ESR1_C	9.9e-20	81.3	Oestrogen-type nuclear receptor final C-terminal
2	PF00104 Hormone_recep	6.9e-30	115.8	Ligand-binding domain of nuclear hormone receptor
3	PF02159 Oest_recep	3.9e-62	220.2	Oestrogen receptor
4	PF00105 zf-C4	5.5e-28	108.5	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227507	0.999	G1/S-specific cyclin-D1
2	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
3	9606.ENSP00000268035	0.999	Insulin-like growth factor 1 receptor
4	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
5	9606.ENSP00000300651	0.999	Mediator of RNA polymerase II transcription subunit 1
6	9606.ENSP00000301396	0.999	Proline-, glutamic acid- and leucine-rich protein 1
7	9606.ENSP00000329357	0.999	Transcription factor Sp1
8	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
9	9606.ENSP00000360266	0.999	Transcription factor AP-1
10	9606.ENSP00000361066	0.999	Nuclear receptor coactivator 3
11	9606.ENSP00000362649	0.999	Histone deacetylase 1
12	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000380033	0.999	Probable ATP-dependent RNA helicase DDX17
14	9606.ENSP00000383063	0.999	Nuclear receptor-interacting protein 1
15	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
16	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
17	9606.ENSP00000399968	0.999	Nuclear receptor coactivator 2
18	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
19	9606.ENSP00000428056	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha
20	9606.ENSP00000242057	0.998	Aryl hydrocarbon receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:0003682	0.998	chromatin binding
GO:0003677	0.998	DNA binding
GO:0003707	0.996	nuclear steroid receptor activity
GO:0140110	0.986	transcription regulator activity
GO:0030284	0.982	nuclear estrogen receptor activity
GO:0042562	0.962	hormone binding
GO:0005496	0.958	steroid binding
GO:0003700	0.949	DNA-binding transcription factor activity
GO:0019899	0.940	enzyme binding
GO:0000981	0.873	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001221	0.857	transcription coregulator binding
GO:0005102	0.768	signaling receptor binding
GO:0001223	0.763	transcription coactivator binding
GO:0043565	0.620	sequence-specific DNA binding
GO:0098531	0.612	ligand-activated transcription factor activity
GO:1990841	0.604	promoter-specific chromatin binding
GO:0044877	0.596	protein-containing complex binding
GO:0004879	0.576	nuclear receptor activity
GO:0035254	0.507	glutamate receptor binding
GO:0043548	0.490	phosphatidylinositol 3-kinase binding
GO:0001664	0.465	G protein-coupled receptor binding
GO:0003690	0.395	double-stranded DNA binding
GO:1990837	0.333	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0048518	0.988	positive regulation of biological process
GO:0009987	0.983	cellular process
GO:0019222	0.976	regulation of metabolic process
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0010468	0.960	regulation of gene expression
GO:0032502	0.940	developmental process
GO:0048522	0.936	positive regulation of cellular process
GO:0042221	0.932	response to chemical
GO:0010033	0.922	response to organic substance
GO:0009893	0.920	positive regulation of metabolic process
GO:0048519	0.904	negative regulation of biological process
GO:0051716	0.895	cellular response to stimulus
GO:0010604	0.860	positive regulation of macromolecule metabolic process
GO:0031328	0.797	positive regulation of cellular biosynthetic process
GO:0048856	0.786	anatomical structure development
GO:0014070	0.783	response to organic cyclic compound
GO:0048583	0.777	regulation of response to stimulus
GO:0045893	0.771	positive regulation of DNA-templated transcription
GO:0023052	0.758	signaling
GO:0007154	0.748	cell communication
GO:0033993	0.730	response to lipid
GO:0007165	0.723	signal transduction
GO:0070887	0.704	cellular response to chemical stimulus
GO:0006357	0.686	regulation of transcription by RNA polymerase II
GO:0071495	0.673	cellular response to endogenous stimulus
GO:0071310	0.643	cellular response to organic substance
GO:0010646	0.635	regulation of cell communication
GO:0023051	0.621	regulation of signaling
GO:0032501	0.603	multicellular organismal process
GO:0048523	0.597	negative regulation of cellular process
GO:0008152	0.594	metabolic process
GO:1901701	0.566	cellular response to oxygen-containing compound
GO:0065009	0.562	regulation of molecular function
GO:0032355	0.535	response to estradiol
GO:0030522	0.499	intracellular receptor signaling pathway
GO:0009892	0.488	negative regulation of metabolic process
GO:0009725	0.481	response to hormone
GO:0032870	0.473	cellular response to hormone stimulus
GO:0071704	0.470	organic substance metabolic process
GO:0009966	0.458	regulation of signal transduction
GO:0071407	0.454	cellular response to organic cyclic compound
GO:0071396	0.446	cellular response to lipid
GO:0048545	0.444	response to steroid hormone
GO:0030518	0.427	intracellular steroid hormone receptor signaling pathway
GO:0044238	0.421	primary metabolic process
GO:0044237	0.411	cellular metabolic process
GO:0071392	0.402	cellular response to estradiol stimulus
GO:0045944	0.396	positive regulation of transcription by RNA polymerase II
GO:0031324	0.394	negative regulation of cellular metabolic process
GO:0010605	0.387	negative regulation of macromolecule metabolic process
GO:0006807	0.344	nitrogen compound metabolic process
GO:0042127	0.336	regulation of cell population proliferation
GO:0010941	0.315	regulation of cell death
GO:0048584	0.306	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0005737	0.988	cytoplasm
GO:0031981	0.958	nuclear lumen
GO:0005654	0.937	nucleoplasm
GO:0005739	0.382	mitochondrion
GO:0030054	0.380	cell junction
GO:0120025	0.372	plasma membrane bounded cell projection
GO:0043204	0.364	perikaryon
GO:0030315	0.364	T-tubule
GO:0048471	0.362	perinuclear region of cytoplasm
GO:0043195	0.362	terminal bouton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]