StarFunc result for job id P03886

User Input

>input (318 residues)
MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEP
LKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSG
WASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWP
LAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTT
IFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL
LMWYVSMPITISSIPPQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03886	1.000	1.000	3.618E-44	318	1.000	1.000	P03886.pdb.gz	NU1M_HUMAN NADH-ubiquinone oxidoreductase chain 1 OS=Homo sapiens OX=9606 GN=MT-ND1 PE=1 SV=1
2	AFDB:P03888	0.999	0.999	1.967E-37	318	0.770	0.770	P03888.pdb.gz	NU1M_MOUSE NADH-ubiquinone oxidoreductase chain 1 OS=Mus musculus OX=10090 GN=Mtnd1 PE=1 SV=3
3	AFDB:P03887	0.999	0.999	2.785E-37	318	0.780	0.780	P03887.pdb.gz	NU1M_BOVIN NADH-ubiquinone oxidoreductase chain 1 OS=Bos taurus OX=9913 GN=MT-ND1 PE=1 SV=1
4	PDB:5xtcs	0.990	0.990	1.041E-35	318	0.994	0.994	5xtcs.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
5	PDB:7qskH	0.995	0.995	1.679E-35	318	0.780	0.780	7qskH.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
6	PDB:7b93H	0.991	0.991	5.425E-35	318	0.770	0.770	7b93H.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
7	PDB:7qsnH	0.901	0.984	1.472E-30	291	0.701	0.766	7qsnH.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
8	AFDB:Q1ZXW0	0.944	0.924	1.328E-24	325	0.428	0.418	Q1ZXW0.pdb.gz	Q1ZXW0_ARATH NADH-ubiquinone oxidoreductase chain 1 OS=Arabidopsis thaliana OX=3702 GN=nad1 PE=3 SV=1
9	AFDB:P0AFD4	0.939	0.919	8.595E-23	325	0.368	0.360	P0AFD4.pdb.gz	NUOH_ECOLI NADH-quinone oxidoreductase subunit H OS=Escherichia coli (strain K12) OX=83333 GN=nuoH PE=1 SV=1
10	AFDB:Q37165	0.926	0.820	1.165E-20	360	0.343	0.303	Q37165.pdb.gz	NU1C_ARATH NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhA PE=1 SV=2
11	AFDB:P0C344	0.919	0.809	1.067E-19	362	0.340	0.298	P0C344.pdb.gz	NU1C_ORYSA NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Oryza sativa OX=4530 GN=ndhA PE=3 SV=1
12	PDB:7wffA	0.854	0.889	1.181E-13	305	0.305	0.318	7wffA.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
13	PDB:7nyrH	0.765	0.893	1.234E-13	270	0.333	0.393	7nyrH.pdb.gz	Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
14	AFDB:P77858	0.853	0.860	8.214E-12	315	0.226	0.229	P77858.pdb.gz	HYFC_ECOLI Hydrogenase-4 component C OS=Escherichia coli (strain K12) OX=83333 GN=hyfC PE=1 SV=1
15	PDB:7z0sD	0.802	0.831	1.904E-10	306	0.217	0.225	7z0sD.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
16	AFDB:P16430	0.838	0.866	6.327E-10	307	0.211	0.218	P16430.pdb.gz	HYCD_ECOLI Formate hydrogenlyase subunit 4 OS=Escherichia coli (strain K12) OX=83333 GN=hycD PE=1 SV=1
17	AFDB:Q38AV6	0.152	0.117	6.318E-2	453	0.135	0.095	Q38AV6.pdb.gz	Q38AV6_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0300 PE=4 SV=1
18	PDB:1qoyA	0.134	0.138	2.467E-1	303	0.094	0.099	1qoyA.pdb.gz
19	PDB:7dgq6	0.142	0.090	3.810E-1	606	0.170	0.089	7dgq6.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
20	PDB:6l7oD	0.399	0.264	5.393E-1	504	0.142	0.089	6l7oD.pdb.gz	Structural insights into NDH-1 mediated cyclic electron transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03886	0.0	620	318	1.000	1.000	NU1M_HUMAN NADH-ubiquinone oxidoreductase chain 1 OS=Homo sapiens OX=9606 GN=MT-ND1 PE=1 SV=1
2	P03888	8.78e-175	488	318	0.767	0.767	NU1M_MOUSE NADH-ubiquinone oxidoreductase chain 1 OS=Mus musculus OX=10090 GN=Mtnd1 PE=1 SV=3
3	P03887	1.21e-174	488	318	0.752	0.752	NU1M_BOVIN NADH-ubiquinone oxidoreductase chain 1 OS=Bos taurus OX=9913 GN=MT-ND1 PE=1 SV=1
4	P03889	6.91e-171	478	318	0.742	0.742	NU1M_RAT NADH-ubiquinone oxidoreductase chain 1 OS=Rattus norvegicus OX=10116 GN=Mtnd1 PE=1 SV=3
5	Q8HCR7	3.55e-98	294	325	0.447	0.437	Q8HCR7_ORYSJ NADH-ubiquinone oxidoreductase chain 1 OS=Oryza sativa subsp. japonica OX=39947 GN=nad1 PE=3 SV=2
6	Q2F9A3	3.10e-87	266	325	0.421	0.412	Q2F9A3_ORYSI NADH-ubiquinone oxidoreductase chain 1 OS=Oryza sativa subsp. indica OX=39946 GN=nad1 PE=3 SV=1
7	Q2F8Z6	3.69e-87	266	325	0.421	0.412	Q2F8Z6_ORYSJ NADH-ubiquinone oxidoreductase chain 1 OS=Oryza sativa subsp. japonica OX=39947 GN=nad1 PE=3 SV=1
8	Q1ZXW0	1.38e-82	254	325	0.406	0.397	Q1ZXW0_ARATH NADH-ubiquinone oxidoreductase chain 1 OS=Arabidopsis thaliana OX=3702 GN=nad1 PE=3 SV=1
9	P0AFD4	8.71e-69	219	325	0.371	0.363	NUOH_ECOLI NADH-quinone oxidoreductase subunit H OS=Escherichia coli (strain K12) OX=83333 GN=nuoH PE=1 SV=1
10	Q37165	3.01e-48	167	360	0.374	0.331	NU1C_ARATH NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhA PE=1 SV=2
11	P0C344	1.83e-46	162	362	0.352	0.309	NU1C_ORYSA NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Oryza sativa OX=4530 GN=ndhA PE=3 SV=1
12	P0C345	1.83e-46	162	362	0.352	0.309	NU1C_ORYSI NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhA PE=3 SV=1
13	P12124	1.83e-46	162	362	0.352	0.309	NU1C_ORYSJ NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhA PE=3 SV=2
14	Q6ENA2	1.83e-46	162	362	0.352	0.309	NU1C_ORYNI NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic OS=Oryza nivara OX=4536 GN=ndhA PE=3 SV=2
15	P16430	6.49e-10	61.6	307	0.186	0.192	HYCD_ECOLI Formate hydrogenlyase subunit 4 OS=Escherichia coli (strain K12) OX=83333 GN=hycD PE=1 SV=1
16	P77858	2.26e-06	50.8	315	0.214	0.216	HYFC_ECOLI Hydrogenase-4 component C OS=Escherichia coli (strain K12) OX=83333 GN=hyfC PE=1 SV=1
17	Q2F941	0.008	38.9	183	0.041	0.071	Q2F941_ORYSJ Uncharacterized protein OS=Oryza sativa subsp. japonica OX=39947 GN=orf183 PE=3 SV=1
18	Q2F992	0.008	38.9	183	0.041	0.071	Q2F992_ORYSI Uncharacterized protein orf183 OS=Oryza sativa subsp. indica OX=39946 GN=orf183 PE=3 SV=1
19	Q8HCQ5	0.008	38.9	183	0.041	0.071	Q8HCQ5_ORYSJ Orf183 protein OS=Oryza sativa subsp. japonica OX=39947 GN=orf183 PE=3 SV=1
20	O18405	2.6	32.0	270	0.091	0.107	SURF4_DROME Surfeit locus protein 4 homolog OS=Drosophila melanogaster OX=7227 GN=Surf4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00146 NADHdh	6e-102	352.6	NADH dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
2	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
3	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
4	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
5	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
6	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
7	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
8	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
9	9606.ENSP00000354554	0.999	Cytochrome b
10	9606.ENSP00000354632	0.999	ATP synthase subunit a
11	9606.ENSP00000354665	0.999	NADH-ubiquinone oxidoreductase chain 6
12	9606.ENSP00000354728	0.999	NADH-ubiquinone oxidoreductase chain 4L
13	9606.ENSP00000354813	0.999	NADH-ubiquinone oxidoreductase chain 5
14	9606.ENSP00000354961	0.999	NADH-ubiquinone oxidoreductase chain 4
15	9606.ENSP00000355046	0.999	NADH-ubiquinone oxidoreductase chain 2
16	9606.ENSP00000355206	0.999	NADH-ubiquinone oxidoreductase chain 3
17	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
18	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
19	9606.ENSP00000392709	0.999	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
20	9606.ENSP00000418842	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0032981	0.980	mitochondrial respiratory chain complex I assembly
GO:0006091	0.977	generation of precursor metabolites and energy
GO:0045333	0.973	cellular respiration
GO:0006119	0.939	oxidative phosphorylation
GO:0022904	0.930	respiratory electron transport chain
GO:0042775	0.912	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.910	aerobic electron transport chain
GO:0006120	0.847	mitochondrial electron transport, NADH to ubiquinone
GO:0050896	0.343	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0031966	0.995	mitochondrial membrane
GO:0005743	0.985	mitochondrial inner membrane
GO:0030964	0.977	NADH dehydrogenase complex
GO:0098798	0.977	mitochondrial protein-containing complex
GO:1902495	0.975	transmembrane transporter complex
GO:0005746	0.975	mitochondrial respirasome
GO:0005747	0.967	mitochondrial respiratory chain complex I
GO:0070013	0.794	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]