StarFunc result for job id P03905

User Input

>input (459 residues)
MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDP
LTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYI
FFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLT
LTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGG
YGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
ILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWL
LASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLT
HHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03905	1.000	1.000	2.821E-64	459	1.000	1.000	P03905.pdb.gz	NU4M_HUMAN NADH-ubiquinone oxidoreductase chain 4 OS=Homo sapiens OX=9606 GN=MT-ND4 PE=1 SV=1
2	AFDB:P03910	0.998	0.998	1.503E-53	459	0.741	0.741	P03910.pdb.gz	NU4M_BOVIN NADH-ubiquinone oxidoreductase chain 4 OS=Bos taurus OX=9913 GN=MT-ND4 PE=1 SV=1
3	AFDB:P03911	0.997	0.997	2.937E-52	459	0.669	0.669	P03911.pdb.gz	NU4M_MOUSE NADH-ubiquinone oxidoreductase chain 4 OS=Mus musculus OX=10090 GN=Mtnd4 PE=1 SV=1
4	PDB:5xtcr	0.988	0.988	6.302E-52	459	0.996	0.996	5xtcr.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
5	AFDB:P05508	0.997	0.997	5.035E-51	459	0.678	0.678	P05508.pdb.gz	NU4M_RAT NADH-ubiquinone oxidoreductase chain 4 OS=Rattus norvegicus OX=10116 GN=Mtnd4 PE=3 SV=3
6	PDB:7qsoM	0.984	0.984	2.952E-50	459	0.741	0.741	7qsoM.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
7	PDB:6g2jM	0.992	0.992	8.171E-43	459	0.669	0.669	6g2jM.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
8	AFDB:Q2F980	0.916	0.851	5.224E-27	495	0.294	0.273	Q2F980.pdb.gz	Q2F980_ORYSI NADH-ubiquinone oxidoreductase chain 4 OS=Oryza sativa subsp. indica OX=39946 GN=nad4 PE=3 SV=1
9	AFDB:Q5F628	0.902	0.834	1.651E-25	498	0.296	0.273	Q5F628.pdb.gz	Q5F628_NEIG1 NADH:ubiquinone oxidoreductase subunit M OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=NGO_1738 PE=3 SV=1
10	AFDB:P0AFE8	0.891	0.807	3.732E-23	509	0.298	0.269	P0AFE8.pdb.gz	NUOM_ECOLI NADH-quinone oxidoreductase subunit M OS=Escherichia coli (strain K12) OX=83333 GN=nuoM PE=1 SV=1
11	AFDB:Q8DKY0	0.876	0.765	2.445E-22	529	0.275	0.238	Q8DKY0.pdb.gz	NU4C1_THEVB NAD(P)H-quinone oxidoreductase chain 4 1 OS=Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) OX=197221 GN=ndhD1 PE=1 SV=2
12	AFDB:P0C323	0.896	0.825	3.786E-22	500	0.257	0.236	P0C323.pdb.gz	NU4C_ORYSA NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Oryza sativa OX=4530 GN=ndhD PE=3 SV=1
13	PDB:7nyhM	0.907	0.830	2.493E-19	504	0.296	0.270	7nyhM.pdb.gz
14	PDB:6l7oD	0.863	0.790	1.010E-18	504	0.270	0.246	6l7oD.pdb.gz	Structural insights into NDH-1 mediated cyclic electron transfer.
15	AFDB:Q9K2S2	0.864	0.511	5.686E-18	801	0.192	0.110	Q9K2S2.pdb.gz	MRPA_BACSU Na(+)/H(+) antiporter subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=mrpA PE=1 SV=2
16	PDB:6humF	0.820	0.626	2.216E-15	611	0.187	0.141	6humF.pdb.gz	Structural adaptations of photosynthetic complex I enable ferredoxin-dependent electron transfer.
17	PDB:7nyhL	0.818	0.625	6.905E-15	612	0.198	0.149	7nyhL.pdb.gz
18	PDB:7z0sC	0.794	0.617	1.807E-14	604	0.207	0.157	7z0sC.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
19	PDB:7wg5F	0.799	0.556	4.726E-14	677	0.229	0.155	7wg5F.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
20	PDB:5xtcl	0.867	0.668	4.938E-14	603	0.200	0.153	5xtcl.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03905	0.0	894	459	1.000	1.000	NU4M_HUMAN NADH-ubiquinone oxidoreductase chain 4 OS=Homo sapiens OX=9606 GN=MT-ND4 PE=1 SV=1
2	P03910	0.0	660	459	0.741	0.741	NU4M_BOVIN NADH-ubiquinone oxidoreductase chain 4 OS=Bos taurus OX=9913 GN=MT-ND4 PE=1 SV=1
3	P03911	0.0	588	459	0.669	0.669	NU4M_MOUSE NADH-ubiquinone oxidoreductase chain 4 OS=Mus musculus OX=10090 GN=Mtnd4 PE=1 SV=1
4	P05508	0.0	604	459	0.678	0.678	NU4M_RAT NADH-ubiquinone oxidoreductase chain 4 OS=Rattus norvegicus OX=10116 GN=Mtnd4 PE=3 SV=3
5	Q5F628	7.87e-62	211	498	0.285	0.263	Q5F628_NEIG1 NADH:ubiquinone oxidoreductase subunit M OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=NGO_1738 PE=3 SV=1
6	Q2F980	8.01e-58	200	495	0.285	0.265	Q2F980_ORYSI NADH-ubiquinone oxidoreductase chain 4 OS=Oryza sativa subsp. indica OX=39946 GN=nad4 PE=3 SV=1
7	Q8HCP7	8.01e-58	200	495	0.285	0.265	Q8HCP7_ORYSJ NADH-ubiquinone oxidoreductase chain 4 OS=Oryza sativa subsp. japonica OX=39947 GN=nad4 PE=3 SV=1
8	P0AFE8	3.10e-50	180	509	0.277	0.250	NUOM_ECOLI NADH-quinone oxidoreductase subunit M OS=Escherichia coli (strain K12) OX=83333 GN=nuoM PE=1 SV=1
9	Q8DKY0	1.44e-41	157	529	0.268	0.233	NU4C1_THEVB NAD(P)H-quinone oxidoreductase chain 4 1 OS=Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) OX=197221 GN=ndhD1 PE=1 SV=2
10	P0C323	7.12e-35	137	500	0.242	0.222	NU4C_ORYSA NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Oryza sativa OX=4530 GN=ndhD PE=3 SV=1
11	P0C324	7.12e-35	137	500	0.242	0.222	NU4C_ORYSI NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhD PE=3 SV=1
12	P0C325	7.12e-35	137	500	0.242	0.222	NU4C_ORYSJ NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhD PE=2 SV=1
13	Q6ENA7	7.12e-35	137	500	0.242	0.222	NU4C_ORYNI NAD(P)H-quinone oxidoreductase chain 4, chloroplastic OS=Oryza nivara OX=4536 GN=ndhD PE=3 SV=1
14	Q35300	3.34e-18	85.9	249	0.120	0.221	Q35300_ORYSJ NADH-ubiquinone oxidoreductase chain 4 (Fragment) OS=Oryza sativa subsp. japonica OX=39947 GN=nad4 PE=3 SV=1
15	P0C326	2.34e-16	84.0	734	0.222	0.139	NU5C_ORYSA NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa OX=4530 GN=ndhF PE=3 SV=1
16	P0C327	2.34e-16	84.0	734	0.222	0.139	NU5C_ORYSI NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhF PE=3 SV=1
17	P0C328	2.34e-16	84.0	734	0.222	0.139	NU5C_ORYSJ NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhF PE=3 SV=1
18	Q6ENB0	2.34e-16	84.0	734	0.222	0.139	NU5C_ORYNI NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza nivara OX=4536 GN=ndhF PE=3 SV=1
19	P77437	5.87e-14	76.3	526	0.124	0.108	HYFF_ECOLI Hydrogenase-4 component F OS=Escherichia coli (strain K12) OX=83333 GN=hyfF PE=3 SV=1
20	P23482	1.04e-13	75.9	672	0.176	0.121	HYFB_ECOLI Hydrogenase-4 component B OS=Escherichia coli (strain K12) OX=83333 GN=hyfB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01059 Oxidored_q5_N	4.6e-25	99.2	NADH-ubiquinone oxidoreductase chain 4, amino terminus
2	PF00361 Proton_antipo_M	1.9e-75	265.4	Proton-conducting membrane transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354961

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
2	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
3	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
4	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
5	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
6	9606.ENSP00000354499	0.999	Cytochrome c oxidase subunit 1
7	9606.ENSP00000354554	0.999	Cytochrome b
8	9606.ENSP00000354632	0.999	ATP synthase subunit a
9	9606.ENSP00000354665	0.999	NADH-ubiquinone oxidoreductase chain 6
10	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
11	9606.ENSP00000354728	0.999	NADH-ubiquinone oxidoreductase chain 4L
12	9606.ENSP00000354813	0.999	NADH-ubiquinone oxidoreductase chain 5
13	9606.ENSP00000354876	0.999	Cytochrome c oxidase subunit 2
14	9606.ENSP00000355046	0.999	NADH-ubiquinone oxidoreductase chain 2
15	9606.ENSP00000355206	0.999	NADH-ubiquinone oxidoreductase chain 3
16	9606.ENSP00000356972	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
17	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
18	9606.ENSP00000418842	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
19	9606.ENSP00000458770	0.999	Acyl carrier protein, mitochondrial
20	9606.ENSP00000315774	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity
GO:0005488	0.956	binding
GO:0005515	0.848	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0010257	0.993	NADH dehydrogenase complex assembly
GO:0033108	0.985	mitochondrial respiratory chain complex assembly
GO:0006119	0.984	oxidative phosphorylation
GO:0032981	0.984	mitochondrial respiratory chain complex I assembly
GO:0019646	0.965	aerobic electron transport chain
GO:0042775	0.965	mitochondrial ATP synthesis coupled electron transport
GO:0006120	0.942	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005743	0.995	mitochondrial inner membrane
GO:1902494	0.994	catalytic complex
GO:0098798	0.992	mitochondrial protein-containing complex
GO:0098803	0.984	respiratory chain complex
GO:0098800	0.981	inner mitochondrial membrane protein complex
GO:0005746	0.980	mitochondrial respirasome
GO:1990204	0.978	oxidoreductase complex
GO:1902495	0.977	transmembrane transporter complex
GO:0005747	0.965	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]