StarFunc result for job id P03915

User Input

>input (603 residues)
MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTFIISLFPTTMFMCLDQE
VIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKY
LLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDI
GFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGP
TPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKK
IVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMG
GLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSITLIATSLTS
AYSTRMILLTLTGQPRFPTLTNINENNPTLLNPIKRLAAGSLFAGFLITNNISPASPFQT
TIPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYL
GLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLL
LIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03915	1.000	1.000	1.185E-75	603	1.000	1.000	P03915.pdb.gz	NU5M_HUMAN NADH-ubiquinone oxidoreductase chain 5 OS=Homo sapiens OX=9606 GN=MT-ND5 PE=1 SV=2
2	PDB:5xtcl	0.987	0.987	1.056E-62	603	0.995	0.995	5xtcl.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
3	AFDB:P03920	0.993	0.988	5.073E-61	606	0.698	0.695	P03920.pdb.gz	NU5M_BOVIN NADH-ubiquinone oxidoreductase chain 5 OS=Bos taurus OX=9913 GN=MT-ND5 PE=1 SV=2
4	AFDB:P11661	0.989	0.980	4.595E-58	609	0.645	0.639	P11661.pdb.gz	NU5M_RAT NADH-ubiquinone oxidoreductase chain 5 OS=Rattus norvegicus OX=10116 GN=Mtnd5 PE=3 SV=3
5	AFDB:P03921	0.985	0.978	1.557E-57	607	0.638	0.634	P03921.pdb.gz	NU5M_MOUSE NADH-ubiquinone oxidoreductase chain 5 OS=Mus musculus OX=10090 GN=Mtnd5 PE=1 SV=3
6	PDB:7b93L	0.987	0.981	7.116E-53	607	0.638	0.634	7b93L.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
7	PDB:7dgq6	0.954	0.949	2.098E-45	606	0.697	0.693	7dgq6.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
8	AFDB:Q2F948	0.902	0.815	9.116E-35	670	0.337	0.303	Q2F948.pdb.gz	Q2F948_ORYSJ NADH-ubiquinone oxidoreductase chain 5 OS=Oryza sativa subsp. japonica OX=39947 GN=nad5 PE=3 SV=1
9	AFDB:P9WIW1	0.878	0.838	1.405E-32	633	0.294	0.280	P9WIW1.pdb.gz	NUOL_MYCTU NADH-quinone oxidoreductase subunit L OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoL PE=1 SV=1
10	AFDB:Q8DKX9	0.869	0.802	2.298E-31	656	0.308	0.284	Q8DKX9.pdb.gz	Q8DKX9_THEVB NADH dehydrogenase subunit 5 OS=Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) OX=197221 GN=ndhF1 PE=1 SV=1
11	AFDB:P33607	0.881	0.868	5.681E-31	613	0.302	0.297	P33607.pdb.gz	NUOL_ECOLI NADH-quinone oxidoreductase subunit L OS=Escherichia coli (strain K12) OX=83333 GN=nuoL PE=1 SV=2
12	AFDB:P56752	0.887	0.722	2.909E-29	746	0.310	0.251	P56752.pdb.gz	NU5C_ARATH NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=1 SV=1
13	AFDB:P0C326	0.867	0.720	4.145E-29	734	0.310	0.255	P0C326.pdb.gz	NU5C_ORYSA NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa OX=4530 GN=ndhF PE=3 SV=1
14	PDB:6humF	0.855	0.844	5.276E-28	611	0.313	0.309	6humF.pdb.gz	Structural adaptations of photosynthetic complex I enable ferredoxin-dependent electron transfer.
15	PDB:7nyhL	0.869	0.857	3.225E-27	612	0.307	0.302	7nyhL.pdb.gz
16	PDB:6nbxF	0.866	0.800	2.980E-25	655	0.308	0.284	6nbxF.pdb.gz	Structure of the complex I-like molecule NDH of oxygenic photosynthesis.
17	PDB:7wg5F	0.808	0.724	1.182E-24	677	0.302	0.269	7wg5F.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
18	PDB:6nbqF	0.705	0.730	1.466E-19	582	0.292	0.302	6nbqF.pdb.gz	Structure of the complex I-like molecule NDH of oxygenic photosynthesis.
19	PDB:7z0sC	0.659	0.658	2.975E-15	604	0.171	0.171	7z0sC.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
20	PDB:6l7oD	0.655	0.775	8.781E-14	504	0.171	0.204	6l7oD.pdb.gz	Structural insights into NDH-1 mediated cyclic electron transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03915	0.0	1201	603	1.000	1.000	NU5M_HUMAN NADH-ubiquinone oxidoreductase chain 5 OS=Homo sapiens OX=9606 GN=MT-ND5 PE=1 SV=2
2	P03920	0.0	843	606	0.690	0.686	NU5M_BOVIN NADH-ubiquinone oxidoreductase chain 5 OS=Bos taurus OX=9913 GN=MT-ND5 PE=1 SV=2
3	P03921	0.0	737	607	0.619	0.614	NU5M_MOUSE NADH-ubiquinone oxidoreductase chain 5 OS=Mus musculus OX=10090 GN=Mtnd5 PE=1 SV=3
4	P11661	0.0	733	609	0.647	0.640	NU5M_RAT NADH-ubiquinone oxidoreductase chain 5 OS=Rattus norvegicus OX=10116 GN=Mtnd5 PE=3 SV=3
5	Q2F999	4.93e-99	311	482	0.295	0.369	Q2F999_ORYSI NADH-ubiquinone oxidoreductase chain 5 OS=Oryza sativa subsp. indica OX=39946 PE=3 SV=2
6	Q8HCR3	1.27e-97	314	670	0.340	0.306	Q8HCR3_ORYSJ NADH-ubiquinone oxidoreductase chain 5 OS=Oryza sativa subsp. japonica OX=39947 GN=nad5 PE=3 SV=3
7	Q2F948	8.64e-97	311	670	0.294	0.264	Q2F948_ORYSJ NADH-ubiquinone oxidoreductase chain 5 OS=Oryza sativa subsp. japonica OX=39947 GN=nad5 PE=3 SV=1
8	P9WIW1	8.08e-86	282	633	0.267	0.254	NUOL_MYCTU NADH-quinone oxidoreductase subunit L OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nuoL PE=1 SV=1
9	Q8DKX9	8.57e-84	277	656	0.257	0.236	Q8DKX9_THEVB NADH dehydrogenase subunit 5 OS=Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) OX=197221 GN=ndhF1 PE=1 SV=1
10	P33607	1.41e-77	259	613	0.267	0.263	NUOL_ECOLI NADH-quinone oxidoreductase subunit L OS=Escherichia coli (strain K12) OX=83333 GN=nuoL PE=1 SV=2
11	P0C326	3.12e-70	243	734	0.255	0.210	NU5C_ORYSA NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa OX=4530 GN=ndhF PE=3 SV=1
12	P0C327	3.12e-70	243	734	0.255	0.210	NU5C_ORYSI NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa subsp. indica OX=39946 GN=ndhF PE=3 SV=1
13	P0C328	3.12e-70	243	734	0.255	0.210	NU5C_ORYSJ NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ndhF PE=3 SV=1
14	Q6ENB0	3.12e-70	243	734	0.255	0.210	NU5C_ORYNI NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Oryza nivara OX=4536 GN=ndhF PE=3 SV=1
15	P56752	7.52e-65	228	746	0.257	0.208	NU5C_ARATH NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ndhF PE=1 SV=1
16	Q9K2S2	2.24e-48	182	801	0.212	0.160	MRPA_BACSU Na(+)/H(+) antiporter subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=mrpA PE=1 SV=2
17	Q9I4S0	1.02e-44	172	933	0.214	0.138	Q9I4S0_PSEAE Probable NADH dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1054 PE=4 SV=1
18	P23482	4.62e-27	118	672	0.192	0.173	HYFB_ECOLI Hydrogenase-4 component B OS=Escherichia coli (strain K12) OX=83333 GN=hyfB PE=1 SV=2
19	P77437	3.72e-25	111	526	0.179	0.205	HYFF_ECOLI Hydrogenase-4 component F OS=Escherichia coli (strain K12) OX=83333 GN=hyfF PE=3 SV=1
20	Q2F980	2.32e-16	84.3	495	0.174	0.212	Q2F980_ORYSI NADH-ubiquinone oxidoreductase chain 4 OS=Oryza sativa subsp. indica OX=39946 GN=nad4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06455 NADH5_C	2.6e-49	178.8	NADH dehydrogenase subunit 5 C-terminus
2	PF00361 Proton_antipo_M	1.2e-69	246.3	Proton-conducting membrane transporter
3	PF00662 Proton_antipo_N	4.3e-07	41.1	NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
2	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
3	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
4	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
5	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
6	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
7	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
8	9606.ENSP00000354554	0.999	Cytochrome b
9	9606.ENSP00000354665	0.999	NADH-ubiquinone oxidoreductase chain 6
10	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
11	9606.ENSP00000354728	0.999	NADH-ubiquinone oxidoreductase chain 4L
12	9606.ENSP00000354961	0.999	NADH-ubiquinone oxidoreductase chain 4
13	9606.ENSP00000355046	0.999	NADH-ubiquinone oxidoreductase chain 2
14	9606.ENSP00000355206	0.999	NADH-ubiquinone oxidoreductase chain 3
15	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
16	9606.ENSP00000418842	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
17	9606.ENSP00000458770	0.999	Acyl carrier protein, mitochondrial
18	9606.ENSP00000315774	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
19	9606.ENSP00000356972	0.998	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
20	9606.ENSP00000389160	0.998	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008137	1.000	NADH dehydrogenase (ubiquinone) activity
GO:0005515	0.883	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0033108	0.993	mitochondrial respiratory chain complex assembly
GO:0006119	0.987	oxidative phosphorylation
GO:0010257	0.985	NADH dehydrogenase complex assembly
GO:0032981	0.984	mitochondrial respiratory chain complex I assembly
GO:0022904	0.961	respiratory electron transport chain
GO:0042773	0.949	ATP synthesis coupled electron transport
GO:0042775	0.920	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.896	aerobic electron transport chain
GO:0006120	0.868	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005743	0.998	mitochondrial inner membrane
GO:1902494	0.994	catalytic complex
GO:0098800	0.991	inner mitochondrial membrane protein complex
GO:0005746	0.990	mitochondrial respirasome
GO:0098803	0.986	respiratory chain complex
GO:1990204	0.973	oxidoreductase complex
GO:1990351	0.968	transporter complex
GO:1902495	0.855	transmembrane transporter complex
GO:0005747	0.828	mitochondrial respiratory chain complex I
GO:0070013	0.349	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	1.000	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	1.000	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]