StarFunc result for job id P03950

User Input

>input (147 residues)
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA
TAGFRNVVVACENGLPVHLDQSIFRRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03950	1.000	1.000	6.779E-32	147	1.000	1.000	P03950.pdb.gz	ANGI_HUMAN Angiogenin OS=Homo sapiens OX=9606 GN=ANG PE=1 SV=1
2	PDB:8af0A	0.818	0.975	4.404E-25	123	0.830	0.992	8af0A.pdb.gz	Structure of angiogenin dimer bound to double-stranded RNA.
3	AFDB:P21570	0.844	0.855	1.753E-23	145	0.687	0.697	P21570.pdb.gz	ANGI_MOUSE Angiogenin OS=Mus musculus OX=10090 GN=Ang PE=1 SV=1
4	AFDB:P10152	0.874	0.869	2.244E-23	148	0.660	0.655	P10152.pdb.gz	ANG1_BOVIN Angiogenin-1 OS=Bos taurus OX=9913 GN=ANG1 PE=1 SV=4
5	AFDB:Q5GAM5	0.796	0.702	3.249E-23	167	0.714	0.629	Q5GAM5.pdb.gz	Q5GAM5_RAT Angiogenin ribonuclease 2 OS=Rattus norvegicus OX=10116 GN=Ang2 PE=1 SV=1
6	PDB:1gv7A	0.765	0.908	3.446E-22	123	0.748	0.894	1gv7A.pdb.gz
7	AFDB:P97802	0.853	0.864	4.075E-22	145	0.571	0.579	P97802.pdb.gz	ANG3_MOUSE Angiogenin-3 OS=Mus musculus OX=10090 GN=Ang3 PE=1 SV=2
8	AFDB:Q3TMQ6	0.824	0.841	1.163E-21	144	0.558	0.569	Q3TMQ6.pdb.gz	ANG4_MOUSE Angiogenin-4 OS=Mus musculus OX=10090 GN=Ang4 PE=1 SV=1
9	AFDB:Q64438	0.859	0.871	2.759E-21	145	0.585	0.593	Q64438.pdb.gz	ANG2_MOUSE Angiogenin-2 OS=Mus musculus OX=10090 GN=Ang2 PE=1 SV=2
10	PDB:1agiA	0.804	0.943	6.658E-21	125	0.558	0.656	1agiA.pdb.gz
11	PDB:2bwlA	0.783	0.973	1.396E-20	118	0.626	0.780	2bwlA.pdb.gz	Structure of Murine Angiogenin: Features of the Substrate- and Cell-Binding Regions and Prospects for Inhibitor-Binding Studies.
12	PDB:3zbwB	0.788	0.953	1.368E-19	121	0.551	0.669	3zbwB.pdb.gz	Crystal Structures of Murine Angiogenin-2 and -3 - Probing 'Structure - Function' Relationships Amongst Angiogenin Homologues.
13	PDB:3zbvA	0.760	0.943	3.905E-19	118	0.537	0.669	3zbvA.pdb.gz	Crystal Structures of Murine Angiogenin-2 and -3 - Probing 'Structure - Function' Relationships Amongst Angiogenin Homologues.
14	AFDB:A5HAK1	0.711	0.697	2.209E-13	150	0.361	0.353	A5HAK1.pdb.gz	A5HAK1_DANRE RNase 2 OS=Danio rerio OX=7955 GN=si:ch211-139g14.6 PE=2 SV=1
15	AFDB:Q9JJH1	0.743	0.739	2.606E-12	148	0.388	0.385	Q9JJH1.pdb.gz	RNAS4_MOUSE Ribonuclease 4 OS=Mus musculus OX=10090 GN=Rnase4 PE=1 SV=1
16	AFDB:P30374	0.638	0.673	2.771E-12	139	0.327	0.345	P30374.pdb.gz	RSFR_CHICK Ribonuclease homolog OS=Gallus gallus OX=9031 PE=2 SV=1
17	PDB:2rnfA	0.688	0.831	2.160E-11	120	0.313	0.383	2rnfA.pdb.gz	The three-dimensional structure of human RNase 4, unliganded and complexed with d(Up), reveals the basis for its uridine selectivity.
18	PDB:1kh8A	0.667	0.776	8.925E-11	125	0.265	0.312	1kh8A.pdb.gz	The crystal structure of the cis-proline to glycine variant (P114G) of ribonuclease A.
19	PDB:3tsrA	0.667	0.784	1.292E-10	124	0.272	0.323	3tsrA.pdb.gz
20	PDB:2e0jA	0.657	0.749	5.021E-10	128	0.272	0.312	2e0jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03950	1.53e-109	309	147	1.000	1.000	ANGI_HUMAN Angiogenin OS=Homo sapiens OX=9606 GN=ANG PE=1 SV=1
2	W0UV28	1.53e-109	309	147	1.000	1.000	W0UV28_HUMAN Ribonuclease A A1 OS=Homo sapiens OX=9606 GN=RAA1 PE=3 SV=1
3	P21570	4.69e-78	229	145	0.728	0.738	ANGI_MOUSE Angiogenin OS=Mus musculus OX=10090 GN=Ang PE=1 SV=1
4	Q5WRG2	9.67e-75	221	145	0.728	0.738	Q5WRG2_RAT Angiogenin OS=Rattus norvegicus OX=10116 GN=Ang PE=1 SV=1
5	Q5GAM6	1.92e-68	205	145	0.653	0.662	Q5GAM6_RAT Ribonuclease A a1 OS=Rattus norvegicus OX=10116 GN=Ang PE=3 SV=1
6	Q5GAM5	9.88e-68	204	167	0.639	0.563	Q5GAM5_RAT Angiogenin ribonuclease 2 OS=Rattus norvegicus OX=10116 GN=Ang2 PE=1 SV=1
7	P10152	5.30e-67	201	148	0.653	0.649	ANG1_BOVIN Angiogenin-1 OS=Bos taurus OX=9913 GN=ANG1 PE=1 SV=4
8	Q64438	2.03e-59	182	145	0.646	0.655	ANG2_MOUSE Angiogenin-2 OS=Mus musculus OX=10090 GN=Ang2 PE=1 SV=2
9	P97802	1.26e-58	180	145	0.639	0.648	ANG3_MOUSE Angiogenin-3 OS=Mus musculus OX=10090 GN=Ang3 PE=1 SV=2
10	Q3TMQ6	5.56e-56	173	144	0.558	0.569	ANG4_MOUSE Angiogenin-4 OS=Mus musculus OX=10090 GN=Ang4 PE=1 SV=1
11	A5HAK1	1.93e-22	88.6	150	0.347	0.340	A5HAK1_DANRE RNase 2 OS=Danio rerio OX=7955 GN=si:ch211-139g14.6 PE=2 SV=1
12	Q9JJH1	2.86e-21	85.5	148	0.333	0.331	RNAS4_MOUSE Ribonuclease 4 OS=Mus musculus OX=10090 GN=Rnase4 PE=1 SV=1
13	P34096	9.74e-21	84.3	147	0.333	0.333	RNAS4_HUMAN Ribonuclease 4 OS=Homo sapiens OX=9606 GN=RNASE4 PE=1 SV=3
14	A5HAK0	5.85e-20	82.4	149	0.340	0.336	RNSL3_DANRE Ribonuclease-like 3 OS=Danio rerio OX=7955 GN=rnasel3 PE=1 SV=2
15	P00684	5.81e-19	79.7	152	0.320	0.309	RNS1B_RAT Ribonuclease pancreatic beta-type OS=Rattus norvegicus OX=10116 GN=Rnase1 PE=1 SV=1
16	P00683	1.67e-17	75.9	149	0.313	0.309	RNAS1_MOUSE Ribonuclease pancreatic OS=Mus musculus OX=10090 GN=Rnase1 PE=1 SV=2
17	P07998	1.46e-16	73.6	156	0.333	0.314	RNAS1_HUMAN Ribonuclease pancreatic OS=Homo sapiens OX=9606 GN=RNASE1 PE=1 SV=4
18	P61823	2.30e-16	73.2	150	0.286	0.280	RNAS1_BOVIN Ribonuclease pancreatic OS=Bos taurus OX=9913 GN=RNASE1 PE=1 SV=1
19	P30374	3.09e-16	72.4	139	0.327	0.345	RSFR_CHICK Ribonuclease homolog OS=Gallus gallus OX=9031 PE=2 SV=1
20	Q27J90	3.09e-16	72.4	139	0.327	0.345	Q27J90_CHICK Leukocyte ribonuclease A-2 OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16592 Cas9_REC	4.5e+02	10.9	REC lobe of CRISPR-associated endonuclease Cas9
2	PF00074 RnaseA	3.6e-31	119.5	Pancreatic ribonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433999	0.999	Ribonuclease inhibitor
2	9606.ENSP00000199389	0.895	Eukaryotic translation initiation factor 2-alpha kinase 1
3	9606.ENSP00000269305	0.863	Cellular tumor antigen p53
4	9606.ENSP00000452245	0.846	Ribonuclease 4
5	9606.ENSP00000303276	0.813	Non-secretory ribonuclease
6	9606.ENSP00000256759	0.795	Follistatin
7	9606.ENSP00000443495	0.792	Alpha-actinin-2
8	9606.ENSP00000302324	0.787	Eosinophil cationic protein
9	9606.ENSP00000369375	0.776	Angiopoietin-1 receptor
10	9606.ENSP00000346032	0.765	Annexin A2
11	9606.ENSP00000311398	0.764	Ribonuclease 8
12	9606.ENSP00000381057	0.756	Ribonuclease pancreatic
13	9606.ENSP00000478570	0.744	Vascular endothelial growth factor A
14	9606.ENSP00000331544	0.713	Fibulin-1
15	9606.ENSP00000254108	0.684	RNA-binding protein FUS
16	9606.ENSP00000264498	0.681	Fibroblast growth factor 2
17	9606.ENSP00000426455	0.679	Ribonuclease T2
18	9606.ENSP00000356530	0.643	2-5A-dependent ribonuclease
19	9606.ENSP00000347665	0.635	Collagen alpha-1(XVIII) chain
20	9606.ENSP00000166139	0.624	Follistatin-related protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004540	1.000	ribonuclease activity
GO:0005488	0.999	binding
GO:0005515	0.984	protein binding
GO:0005102	0.852	signaling receptor binding
GO:0097159	0.637	organic cyclic compound binding
GO:1901363	0.554	heterocyclic compound binding
GO:0003676	0.476	nucleic acid binding
GO:0003723	0.394	RNA binding
GO:0042802	0.361	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0048518	0.990	positive regulation of biological process
GO:0009987	0.986	cellular process
GO:0050794	0.974	regulation of cellular process
GO:0071704	0.944	organic substance metabolic process
GO:0032501	0.932	multicellular organismal process
GO:0048522	0.926	positive regulation of cellular process
GO:0048856	0.908	anatomical structure development
GO:0044238	0.890	primary metabolic process
GO:0006950	0.885	response to stress
GO:0044237	0.855	cellular metabolic process
GO:0009605	0.854	response to external stimulus
GO:0007275	0.826	multicellular organism development
GO:0006807	0.806	nitrogen compound metabolic process
GO:0006952	0.788	defense response
GO:0098542	0.779	defense response to other organism
GO:0043170	0.754	macromolecule metabolic process
GO:0048731	0.715	system development
GO:1901360	0.710	organic cyclic compound metabolic process
GO:0042127	0.709	regulation of cell population proliferation
GO:0006725	0.703	cellular aromatic compound metabolic process
GO:0006955	0.690	immune response
GO:0006959	0.641	humoral immune response
GO:0019730	0.607	antimicrobial humoral response
GO:0006139	0.590	nucleobase-containing compound metabolic process
GO:0048519	0.589	negative regulation of biological process
GO:0061844	0.555	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0019222	0.517	regulation of metabolic process
GO:0019731	0.490	antibacterial humoral response
GO:0060255	0.464	regulation of macromolecule metabolic process
GO:0048523	0.464	negative regulation of cellular process
GO:0051171	0.454	regulation of nitrogen compound metabolic process
GO:0080090	0.451	regulation of primary metabolic process
GO:0031323	0.451	regulation of cellular metabolic process
GO:0009893	0.442	positive regulation of metabolic process
GO:0065009	0.431	regulation of molecular function
GO:0010604	0.409	positive regulation of macromolecule metabolic process
GO:0051716	0.407	cellular response to stimulus
GO:0042221	0.386	response to chemical
GO:0050790	0.340	regulation of catalytic activity
GO:0031325	0.325	positive regulation of cellular metabolic process
GO:0019220	0.314	regulation of phosphate metabolic process
GO:0051173	0.310	positive regulation of nitrogen compound metabolic process
GO:0051246	0.301	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.996	intracellular organelle lumen
GO:0043227	0.993	membrane-bounded organelle
GO:0005576	0.988	extracellular region
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005634	0.971	nucleus
GO:0043228	0.949	non-membrane-bounded organelle
GO:0031981	0.942	nuclear lumen
GO:0043232	0.933	intracellular non-membrane-bounded organelle
GO:0005615	0.917	extracellular space
GO:0005737	0.873	cytoplasm
GO:0031982	0.790	vesicle
GO:0005856	0.582	cytoskeleton
GO:0005730	0.379	nucleolus
GO:0005694	0.363	chromosome
GO:0071944	0.357	cell periphery
GO:0015629	0.303	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]