StarFunc result for job id P03956

User Input

>input (469 residues)
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03956	1.000	1.000	9.463E-102	469	1.000	1.000	P03956.pdb.gz	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
2	PDB:1su3B	0.882	0.995	6.601E-86	416	0.885	0.998	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
3	AFDB:Q9EPL5	0.911	0.921	2.751E-69	464	0.586	0.593	Q9EPL5.pdb.gz	MMP1A_MOUSE Interstitial collagenase A OS=Mus musculus OX=10090 GN=Mmp1a PE=2 SV=1
4	AFDB:P22894	0.836	0.839	8.121E-69	467	0.574	0.576	P22894.pdb.gz	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
5	AFDB:Q9EPL6	0.858	0.869	1.402E-67	463	0.565	0.572	Q9EPL6.pdb.gz	MMP1B_MOUSE Interstitial collagenase B OS=Mus musculus OX=10090 GN=Mmp1b PE=2 SV=1
6	AFDB:O88766	0.848	0.853	1.294E-66	466	0.544	0.547	O88766.pdb.gz	MMP8_RAT Neutrophil collagenase OS=Rattus norvegicus OX=10116 GN=Mmp8 PE=2 SV=1
7	AFDB:O55123	0.488	0.481	2.503E-65	476	0.525	0.517	O55123.pdb.gz	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
8	AFDB:P28862	0.520	0.512	6.228E-65	477	0.533	0.524	P28862.pdb.gz	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
9	AFDB:P08254	0.509	0.501	9.595E-64	477	0.529	0.520	P08254.pdb.gz	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
10	AFDB:P03957	0.507	0.501	1.351E-63	475	0.525	0.518	P03957.pdb.gz	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
11	AFDB:P09238	0.524	0.517	1.901E-63	476	0.520	0.513	P09238.pdb.gz	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
12	PDB:1gxdA	0.817	0.623	1.756E-42	624	0.403	0.303	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
13	PDB:2mzeA	0.435	0.777	2.660E-21	250	0.247	0.464	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
14	PDB:3lp9A	0.338	0.669	1.270E-9	227	0.081	0.167	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:1nr0A	0.232	0.188	3.191E-7	610	0.030	0.023	1nr0A.pdb.gz
16	PDB:1aklA	0.255	0.255	4.243E-7	470	0.100	0.100	1aklA.pdb.gz	Crystal structure of the unliganded alkaline protease from Pseudomonas aeruginosa IFO3080 and its conformational changes on ligand binding.
17	PDB:1af0A	0.251	0.250	7.940E-7	470	0.109	0.109	1af0A.pdb.gz	Kinetic characterization of the serralysins: a divergent catalytic mechanism pertaining to astacin-type metalloproteases.
18	PDB:5c2vB	0.217	0.272	2.481E-6	352	0.030	0.040	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
19	PDB:2h9lA	0.207	0.282	5.204E-6	321	0.034	0.050	2h9lA.pdb.gz
20	PDB:5wyjBE	0.200	0.138	5.832E-6	753	0.038	0.024	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70138	0.0	536	465	0.552	0.557	MMP8_MOUSE Neutrophil collagenase OS=Mus musculus OX=10090 GN=Mmp8 PE=2 SV=2
2	O88766	0.0	522	466	0.546	0.549	MMP8_RAT Neutrophil collagenase OS=Rattus norvegicus OX=10116 GN=Mmp8 PE=2 SV=1
3	P03956	0.0	982	469	1.000	1.000	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
4	P22894	0.0	556	467	0.563	0.565	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
5	P28862	0.0	523	477	0.548	0.539	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
6	Q9EPL5	0.0	557	464	0.574	0.580	MMP1A_MOUSE Interstitial collagenase A OS=Mus musculus OX=10090 GN=Mmp1a PE=2 SV=1
7	Q9EPL6	0.0	530	463	0.571	0.579	MMP1B_MOUSE Interstitial collagenase B OS=Mus musculus OX=10090 GN=Mmp1b PE=2 SV=1
8	P03957	1.08e-178	510	475	0.531	0.524	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
9	O55123	6.31e-177	506	476	0.527	0.519	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
10	P08254	1.31e-176	505	477	0.544	0.535	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
11	P09238	2.48e-167	481	476	0.525	0.517	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
12	P33435	1.69e-156	454	472	0.471	0.468	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
13	P39900	5.06e-156	452	470	0.493	0.491	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
14	P45452	9.31e-156	452	471	0.471	0.469	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
15	P23097	2.14e-153	446	466	0.463	0.466	MMP13_RAT Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1
16	Q9H306	1.88e-152	445	513	0.490	0.448	MMP27_HUMAN Matrix metalloproteinase-27 OS=Homo sapiens OX=9606 GN=MMP27 PE=1 SV=2
17	B5X4P7	5.17e-143	419	473	0.482	0.478	B5X4P7_SALSA Collagenase 3 OS=Salmo salar OX=8030 GN=MMP13 PE=2 SV=1
18	Q9DEE0	2.83e-138	407	475	0.469	0.463	Q9DEE0_ONCMY Matrix metalloproteinase OS=Oncorhynchus mykiss OX=8022 GN=mmp PE=2 SV=1
19	O60882	5.97e-134	397	483	0.446	0.433	MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens OX=9606 GN=MMP20 PE=1 SV=3
20	F1QCX8	1.15e-133	396	476	0.456	0.450	F1QCX8_DANRE Matrix metallopeptidase 13a OS=Danio rerio OX=7955 GN=cb1034 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	4.5	18.4	Astacin (Peptidase family M12A)
2	PF16313 DUF4953	1.6e+02	12.9	Met-zincin
3	PF03032 FSAP_sig_propep	4.9e+02	12.2	Frog skin active peptide family signal and propeptide
4	PF00045 Hemopexin	1.3e-43	157.9	Hemopexin
5	PF12044 Metallopep	4.9e+02	10.6	Putative peptidase family
6	PF00413 Peptidase_M10	5.7e-59	210.0	Matrixin
7	PF07998 Peptidase_M54	1.2e+02	14.1	Peptidase family M54
8	PF10462 Peptidase_M66	1.3e+02	12.9	Peptidase M66
9	PF01471 PG_binding_1	6.2e-10	50.4	Putative peptidoglycan binding domain
10	PF13582 Reprolysin_3	20	17.1	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	1.1e+02	13.9	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	80	14.8	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218388	0.999	Metalloproteinase inhibitor 1
2	9606.ENSP00000387356	0.974	Aggrecan core protein
3	9606.ENSP00000385675	0.973	Interleukin-6
4	9606.ENSP00000264657	0.969	Signal transducer and activator of transcription 3
5	9606.ENSP00000333769	0.968	Basigin
6	9606.ENSP00000478570	0.967	Vascular endothelial growth factor A
7	9606.ENSP00000308938	0.962	Plasminogen
8	9606.ENSP00000361405	0.961	Matrix metalloproteinase-9
9	9606.ENSP00000221930	0.960	Transforming growth factor beta-1
10	9606.ENSP00000264498	0.959	Fibroblast growth factor 2
11	9606.ENSP00000412237	0.955	Interleukin-10
12	9606.ENSP00000299855	0.953	Stromelysin-1
13	9606.ENSP00000222390	0.952	Hepatocyte growth factor
14	9606.ENSP00000262768	0.950	Metalloproteinase inhibitor 2
15	9606.ENSP00000362108	0.949	Neutrophil gelatinase-associated lipocalin
16	9606.ENSP00000370473	0.949	Insulin-like growth factor-binding protein 3
17	9606.ENSP00000344192	0.947	Interleukin-17A
18	9606.ENSP00000302665	0.946	Insulin-like growth factor I
19	9606.ENSP00000466090	0.944	Neutrophil elastase
20	9606.ENSP00000250378	0.940	Chymase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008270	1.000	zinc ion binding
GO:0004222	1.000	metalloendopeptidase activity
GO:0004252	0.999	serine-type endopeptidase activity
GO:0005515	0.872	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.996	response to stimulus
GO:0065007	0.995	biological regulation
GO:0050794	0.989	regulation of cellular process
GO:0008152	0.988	metabolic process
GO:0051716	0.963	cellular response to stimulus
GO:0022617	0.958	extracellular matrix disassembly
GO:0048518	0.957	positive regulation of biological process
GO:0032963	0.939	collagen metabolic process
GO:0071704	0.935	organic substance metabolic process
GO:0044238	0.923	primary metabolic process
GO:0006807	0.912	nitrogen compound metabolic process
GO:0043170	0.893	macromolecule metabolic process
GO:1901564	0.856	organonitrogen compound metabolic process
GO:0019538	0.823	protein metabolic process
GO:0048522	0.817	positive regulation of cellular process
GO:0006508	0.794	proteolysis
GO:0009056	0.762	catabolic process
GO:0019222	0.597	regulation of metabolic process
GO:0009628	0.583	response to abiotic stimulus
GO:0048583	0.571	regulation of response to stimulus
GO:0032501	0.557	multicellular organismal process
GO:0048519	0.548	negative regulation of biological process
GO:0044087	0.488	regulation of cellular component biogenesis
GO:0060255	0.472	regulation of macromolecule metabolic process
GO:0009893	0.453	positive regulation of metabolic process
GO:0042221	0.447	response to chemical
GO:0051171	0.438	regulation of nitrogen compound metabolic process
GO:0051239	0.418	regulation of multicellular organismal process
GO:0051128	0.418	regulation of cellular component organization
GO:0009314	0.409	response to radiation
GO:0010604	0.404	positive regulation of macromolecule metabolic process
GO:0032502	0.400	developmental process
GO:0048523	0.392	negative regulation of cellular process
GO:0006950	0.391	response to stress
GO:0048856	0.385	anatomical structure development
GO:0031323	0.376	regulation of cellular metabolic process
GO:0070887	0.365	cellular response to chemical stimulus
GO:0009416	0.356	response to light stimulus
GO:0080090	0.333	regulation of primary metabolic process
GO:0010468	0.333	regulation of gene expression
GO:0071214	0.322	cellular response to abiotic stimulus
GO:0010033	0.318	response to organic substance
GO:0009605	0.316	response to external stimulus
GO:0009411	0.305	response to UV
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.850	intracellular anatomical structure
GO:0043227	0.847	membrane-bounded organelle
GO:0005615	0.838	extracellular space
GO:0071944	0.721	cell periphery
GO:0005737	0.636	cytoplasm
GO:0043229	0.635	intracellular organelle
GO:0070013	0.631	intracellular organelle lumen
GO:0043231	0.589	intracellular membrane-bounded organelle
GO:0031982	0.455	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.21.-	0.999	Serine endopeptidases.

[back to server]