StarFunc result for job id P03971

User Input

>input (560 residues)
MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALG
GDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGA
WLRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAG
LPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHR
CFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRA
LRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDP
APLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIP
ETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLS
EERISAHHVPNMVATECGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P03971	1.000	1.000	3.903E-103	560	1.000	1.000	P03971.pdb.gz	MIS_HUMAN Muellerian-inhibiting factor OS=Homo sapiens OX=9606 GN=AMH PE=1 SV=3
2	AFDB:P27106	0.524	0.528	2.849E-74	555	0.711	0.717	P27106.pdb.gz	MIS_MOUSE Muellerian-inhibiting factor OS=Mus musculus OX=10090 GN=Amh PE=2 SV=2
3	AFDB:E3UBG7	0.262	0.258	1.655E-24	571	0.268	0.263	E3UBG7.pdb.gz	E3UBG7_SALSA Anti-mullerian hormone OS=Salmo salar OX=8030 PE=3 SV=1
4	AFDB:A8E7B8	0.256	0.260	2.399E-23	549	0.236	0.240	A8E7B8.pdb.gz	A8E7B8_DANRE Anti-Mullerian hormone OS=Danio rerio OX=7955 GN=amh PE=1 SV=1
5	AFDB:P55108	0.279	0.316	4.098E-12	476	0.184	0.216	P55108.pdb.gz	GDF10_RAT Growth/differentiation factor 10 OS=Rattus norvegicus OX=10116 GN=Gdf10 PE=2 SV=1
6	AFDB:P55107	0.259	0.292	1.094E-11	478	0.170	0.199	P55107.pdb.gz	GDF10_HUMAN Growth/differentiation factor 10 OS=Homo sapiens OX=9606 GN=GDF10 PE=2 SV=1
7	AFDB:P49002	0.248	0.283	2.106E-11	468	0.141	0.169	P49002.pdb.gz	BMP3_RAT Bone morphogenetic protein 3 OS=Rattus norvegicus OX=10116 GN=Bmp3 PE=2 SV=1
8	AFDB:P12645	0.277	0.315	1.675E-10	472	0.145	0.172	P12645.pdb.gz	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
9	AFDB:A0JML2	0.265	0.309	2.083E-10	452	0.132	0.164	A0JML2.pdb.gz	A0JML2_DANRE Bone morphogenetic protein 3 OS=Danio rerio OX=7955 GN=zgc:153939 PE=2 SV=1
10	AFDB:Q91620	0.175	0.241	2.678E-8	405	0.111	0.153	Q91620.pdb.gz	NOD2A_XENLA Nodal homolog 2-A OS=Xenopus laevis OX=8355 GN=nodal2-a PE=1 SV=1
11	PDB:3rjrC	0.141	0.219	6.536E-6	343	0.054	0.087	3rjrC.pdb.gz
12	PDB:5vqfB	0.137	0.229	1.403E-5	320	0.046	0.081	5vqfB.pdb.gz
13	PDB:5ntuA	0.152	0.234	3.181E-5	308	0.102	0.185	5ntuA.pdb.gz
14	PDB:7y1rB	0.135	0.231	8.042E-5	308	0.057	0.104	7y1rB.pdb.gz
15	PDB:6umxA	0.158	0.269	8.493E-5	279	0.086	0.172	6umxA.pdb.gz
16	PDB:6q2sA	0.121	0.534	2.979E-4	98	0.048	0.276	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
17	PDB:5nxsA	0.131	0.243	3.146E-4	290	0.048	0.093	5nxsA.pdb.gz
18	PDB:5ffoG	0.176	0.299	5.430E-4	297	0.098	0.185	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:4mqwB	0.100	0.400	5.611E-2	109	0.030	0.156	4mqwB.pdb.gz
20	PDB:7ag0A	0.106	0.369	5.611E-2	140	0.029	0.114	7ag0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P03971	0.0	1075	560	1.000	1.000	MIS_HUMAN Muellerian-inhibiting factor OS=Homo sapiens OX=9606 GN=AMH PE=1 SV=3
2	P27106	0.0	658	554	0.721	0.729	MIS_MOUSE Muellerian-inhibiting factor OS=Mus musculus OX=10090 GN=Amh PE=2 SV=2
3	P49000	0.0	674	553	0.705	0.714	MIS_RAT Muellerian-inhibiting factor OS=Rattus norvegicus OX=10116 GN=Amh PE=2 SV=1
4	A8E7B8	1.33e-23	107	549	0.248	0.253	A8E7B8_DANRE Anti-Mullerian hormone OS=Danio rerio OX=7955 GN=amh PE=1 SV=1
5	Q6B6Q2	2.53e-23	105	549	0.246	0.251	Q6B6Q2_DANRE Anti-mullerian hormone OS=Danio rerio OX=7955 GN=amh PE=1 SV=2
6	E3UBG7	4.81e-22	102	571	0.266	0.261	E3UBG7_SALSA Anti-mullerian hormone OS=Salmo salar OX=8030 PE=3 SV=1
7	Q5XZF0	9.09e-22	101	571	0.264	0.259	Q5XZF0_SALSA Anti-mullerian hormone OS=Salmo salar OX=8030 GN=LOC100136452 PE=2 SV=1
8	P20863	2.03e-07	55.5	357	0.104	0.162	GDF1_MOUSE Embryonic growth/differentiation factor 1 OS=Mus musculus OX=10090 GN=Gdf1 PE=2 SV=2
9	O42222	1.94e-06	52.8	374	0.066	0.099	GDF8_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=mstnb PE=2 SV=2
10	Q9YGV1	2.01e-06	52.4	354	0.062	0.099	GDF3_XENLA Growth/differentiation factor 3 OS=Xenopus laevis OX=8355 GN=gdf3 PE=1 SV=1
11	Q5I3Q2	3.95e-06	51.6	376	0.066	0.098	GDF8_EPICO Growth/differentiation factor 8 OS=Epinephelus coioides OX=94232 GN=gdf-8 PE=1 SV=1
12	Q9Z1W4	9.18e-06	50.4	405	0.077	0.106	GDF11_MOUSE Growth/differentiation factor 11 OS=Mus musculus OX=10090 GN=Gdf11 PE=1 SV=1
13	Q9Z217	9.18e-06	50.4	405	0.077	0.106	GDF11_RAT Growth/differentiation factor 11 OS=Rattus norvegicus OX=10116 GN=Gdf11 PE=2 SV=2
14	H0YI30	9.53e-06	50.4	380	0.077	0.113	H0YI30_HUMAN Growth differentiation factor 11 (Fragment) OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
15	O95390	9.71e-06	50.4	407	0.077	0.106	GDF11_HUMAN Growth/differentiation factor 11 OS=Homo sapiens OX=9606 GN=GDF11 PE=1 SV=1
16	D2TEB7	1.02e-05	50.4	416	0.062	0.084	D2TEB7_DANRE Bone morphogenetic protein 16 OS=Danio rerio OX=7955 GN=bmp16 PE=2 SV=1
17	Q8UVQ2	1.12e-05	50.1	391	0.052	0.074	Q8UVQ2_DANRE Anti-dorsalizing morphogenetic protein OS=Danio rerio OX=7955 GN=wu:fe05b04 PE=2 SV=1
18	Q6KF10	1.28e-05	50.1	455	0.059	0.073	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
19	P43028	1.62e-05	50.1	454	0.059	0.073	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
20	D1LWV1	1.71e-05	49.7	375	0.064	0.096	D1LWV1_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04709 AMH_N	6.6e-144	491.3	Anti-Mullerian hormone, N terminal region
2	PF00019 TGF_beta	2e-11	56.0	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221496

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257863	0.998	Anti-Muellerian hormone type-2 receptor
2	9606.ENSP00000245479	0.983	Transcription factor SOX-9
3	9606.ENSP00000362690	0.975	Steroidogenic factor 1
4	9606.ENSP00000334458	0.966	Transcription factor GATA-4
5	9606.ENSP00000263640	0.956	Activin receptor type-1
6	9606.ENSP00000441954	0.950	Mothers against decapentaplegic homolog 5
7	9606.ENSP00000369154	0.947	Mothers against decapentaplegic homolog 9
8	9606.ENSP00000426568	0.932	Mothers against decapentaplegic homolog 1
9	9606.ENSP00000333188	0.928	Forkhead box protein L2
10	9606.ENSP00000371711	0.915	Doublesex- and mab-3-related transcription factor 1
11	9606.ENSP00000361107	0.914	Bone morphogenetic protein receptor type-1A
12	9606.ENSP00000383003	0.906	Peptidyl-prolyl cis-trans isomerase FKBP1A
13	9606.ENSP00000367942	0.879	Growth/differentiation factor 9
14	9606.ENSP00000384708	0.851	Follicle-stimulating hormone receptor
15	9606.ENSP00000379683	0.843	Aromatase
16	9606.ENSP00000363708	0.831	Bone morphogenetic protein receptor type-2
17	9606.ENSP00000276414	0.825	Progonadoliberin-1
18	9606.ENSP00000368253	0.810	Nuclear receptor subfamily 0 group B member 1
19	9606.ENSP00000401907	0.807	Bone morphogenetic protein receptor type-1B
20	9606.ENSP00000369816	0.768	Sex hormone-binding globulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005160	1.000	transforming growth factor beta receptor binding
GO:0048018	0.999	receptor ligand activity
GO:0005179	0.921	hormone activity
GO:0005114	0.644	type II transforming growth factor beta receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0065007	0.995	biological regulation
GO:0009987	0.992	cellular process
GO:0050896	0.991	response to stimulus
GO:0032501	0.991	multicellular organismal process
GO:0050794	0.989	regulation of cellular process
GO:0048513	0.986	animal organ development
GO:0003006	0.985	developmental process involved in reproduction
GO:0048731	0.984	system development
GO:0007548	0.984	sex differentiation
GO:0023052	0.978	signaling
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0010468	0.939	regulation of gene expression
GO:0009653	0.927	anatomical structure morphogenesis
GO:0046661	0.919	male sex differentiation
GO:0007167	0.917	enzyme-linked receptor protein signaling pathway
GO:0048518	0.911	positive regulation of biological process
GO:0007178	0.875	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009893	0.852	positive regulation of metabolic process
GO:0071704	0.841	organic substance metabolic process
GO:0044238	0.835	primary metabolic process
GO:0010604	0.806	positive regulation of macromolecule metabolic process
GO:0044237	0.798	cellular metabolic process
GO:0048519	0.764	negative regulation of biological process
GO:0006807	0.732	nitrogen compound metabolic process
GO:0043170	0.708	macromolecule metabolic process
GO:0007530	0.694	sex determination
GO:0061458	0.678	reproductive system development
GO:0060033	0.632	anatomical structure regression
GO:0031323	0.618	regulation of cellular metabolic process
GO:0051171	0.549	regulation of nitrogen compound metabolic process
GO:0080090	0.547	regulation of primary metabolic process
GO:0045137	0.547	development of primary sexual characteristics
GO:0008406	0.544	gonad development
GO:1901564	0.525	organonitrogen compound metabolic process
GO:0030154	0.500	cell differentiation
GO:0048522	0.498	positive regulation of cellular process
GO:0009889	0.457	regulation of biosynthetic process
GO:0031326	0.406	regulation of cellular biosynthetic process
GO:0019538	0.400	protein metabolic process
GO:0019219	0.382	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.360	regulation of macromolecule biosynthetic process
GO:0050793	0.356	regulation of developmental process
GO:0051252	0.342	regulation of RNA metabolic process
GO:0006355	0.333	regulation of DNA-templated transcription
GO:0036211	0.325	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.867	extracellular space
GO:0005622	0.856	intracellular anatomical structure
GO:0005737	0.773	cytoplasm
GO:0043226	0.585	organelle
GO:0043227	0.532	membrane-bounded organelle
GO:0070013	0.419	intracellular organelle lumen
GO:0043231	0.343	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]