StarFunc result for job id P04003

User Input

>input (597 residues)
MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAA
PMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELR
NGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPD
IRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCR
KPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCI
NLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGC
EALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP
SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQC
KALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEW
ETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04003	1.000	1.000	0.000	597	1.000	1.000	P04003.pdb.gz	C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2
2	AFDB:Q63514	0.489	0.519	4.937E-74	558	0.564	0.604	Q63514.pdb.gz	C4BPA_RAT C4b-binding protein alpha chain OS=Rattus norvegicus OX=10116 GN=C4bpa PE=2 SV=1
3	AFDB:O08569	0.511	0.570	2.021E-61	533	0.492	0.552	O08569.pdb.gz	ZP3R_CAVPO Zona pellucida sperm-binding protein 3 receptor OS=Cavia porcellus OX=10141 GN=ZP3R PE=1 SV=1
4	AFDB:Q60736	0.474	0.488	2.795E-60	579	0.456	0.470	Q60736.pdb.gz	ZP3R_MOUSE Zona pellucida sperm-binding protein 3 receptor OS=Mus musculus OX=10090 GN=Zp3r PE=1 SV=1
5	AFDB:Q7TSY4	0.427	0.440	7.914E-59	577	0.471	0.487	Q7TSY4.pdb.gz	ZP3R_RAT Zona pellucida sperm-binding protein 3 receptor OS=Rattus norvegicus OX=10116 GN=Zp3r PE=2 SV=1
6	AFDB:P08607	0.319	0.392	1.482E-49	469	0.410	0.522	P08607.pdb.gz	C4BPA_MOUSE C4b-binding protein OS=Mus musculus OX=10090 GN=C4bpa PE=1 SV=3
7	AFDB:Q2VPA4	0.324	0.339	1.174E-40	569	0.268	0.281	Q2VPA4.pdb.gz	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
8	AFDB:Q63135	0.356	0.378	4.823E-38	559	0.256	0.274	Q63135.pdb.gz	CR1L_RAT Complement component receptor 1-like protein OS=Rattus norvegicus OX=10116 GN=Cr1l PE=1 SV=1
9	AFDB:P17927	0.314	0.098	7.776E-38	2039	0.286	0.084	P17927.pdb.gz	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
10	AFDB:P20023	0.230	0.142	2.962E-37	1033	0.286	0.166	P20023.pdb.gz	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
11	PDB:2gsxA	0.207	0.142	5.520E-33	951	0.271	0.170	2gsxA.pdb.gz
12	PDB:2q7zA	0.198	0.092	7.560E-31	1931	0.281	0.087	2q7zA.pdb.gz
13	PDB:1haqA	0.158	0.095	7.899E-21	1213	0.216	0.106	1haqA.pdb.gz
14	PDB:1c1zA	0.320	0.531	5.872E-20	326	0.127	0.233	1c1zA.pdb.gz
15	PDB:8a7eC	0.199	0.093	6.887E-12	1524	0.129	0.051	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.140	0.120	4.349E-9	714	0.072	0.060	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:8a7dQ	0.150	0.264	3.391E-8	273	0.074	0.161	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:3t5oA	0.132	0.097	5.956E-7	871	0.082	0.056	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:4e0sB	0.105	0.076	1.624E-6	898	0.072	0.048	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:7nycC	0.121	0.093	3.487E-6	809	0.065	0.048	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08569	0.0	580	533	0.492	0.552	ZP3R_CAVPO Zona pellucida sperm-binding protein 3 receptor OS=Cavia porcellus OX=10141 GN=ZP3R PE=1 SV=1
2	P04003	0.0	1238	597	1.000	1.000	C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2
3	Q60736	0.0	550	579	0.464	0.478	ZP3R_MOUSE Zona pellucida sperm-binding protein 3 receptor OS=Mus musculus OX=10090 GN=Zp3r PE=1 SV=1
4	Q63514	0.0	702	558	0.564	0.604	C4BPA_RAT C4b-binding protein alpha chain OS=Rattus norvegicus OX=10116 GN=C4bpa PE=2 SV=1
5	Q7TSY4	0.0	558	577	0.474	0.490	ZP3R_RAT Zona pellucida sperm-binding protein 3 receptor OS=Rattus norvegicus OX=10116 GN=Zp3r PE=2 SV=1
6	P08607	1.02e-106	331	469	0.307	0.390	C4BPA_MOUSE C4b-binding protein OS=Mus musculus OX=10090 GN=C4bpa PE=1 SV=3
7	D3Z9F7	1.22e-69	247	1406	0.280	0.119	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
8	Q9DEG0	3.76e-67	227	451	0.253	0.335	Q9DEG0_CHICK Complement regulatory membrane protein OS=Gallus gallus OX=9031 GN=Cremp PE=2 SV=1
9	P19070	2.00e-66	236	1025	0.295	0.172	CR2_MOUSE Complement receptor type 2 OS=Mus musculus OX=10090 GN=Cr2 PE=1 SV=1
10	P20023	1.44e-64	231	1033	0.288	0.167	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
11	Q63135	3.58e-64	222	559	0.251	0.268	CR1L_RAT Complement component receptor 1-like protein OS=Rattus norvegicus OX=10116 GN=Cr1l PE=1 SV=1
12	P17927	3.37e-55	204	2039	0.288	0.084	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
13	Q4LDE5	2.93e-51	193	3571	0.246	0.041	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
14	Q64735	9.25e-50	181	483	0.189	0.234	CR1L_MOUSE Complement component receptor 1-like protein OS=Mus musculus OX=10090 GN=Cr1l PE=1 SV=1
15	Q2VPA4	2.13e-49	182	569	0.253	0.265	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
16	A2AVA0	5.42e-48	183	3567	0.245	0.041	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
17	O02839	1.40e-43	161	363	0.166	0.273	MCP_PIG Membrane cofactor protein OS=Sus scrofa OX=9823 GN=CD46 PE=1 SV=1
18	A0A024CBD6	2.23e-43	160	363	0.166	0.273	A0A024CBD6_PIG Membrane cofactor protein OS=Sus scrofa OX=9823 PE=2 SV=1
19	P15529	1.34e-40	154	392	0.161	0.245	MCP_HUMAN Membrane cofactor protein OS=Homo sapiens OX=9606 GN=CD46 PE=1 SV=3
20	Q80T79	8.75e-40	159	3707	0.236	0.038	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18453 C4bp_oligo	5e-26	102.0	Oligomerization domain of C4b-binding protein alpha
2	PF01681 C6	51	15.8	C6 domain
3	PF00084 Sushi	6.8e-71	245.9	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356037

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396688	0.972	Complement C4-A
2	9606.ENSP00000361359	0.965	Tumor necrosis factor receptor superfamily member 5
3	9606.ENSP00000415941	0.955	Complement C4-B
4	9606.ENSP00000377783	0.926	Vitamin K-dependent protein S
5	9606.ENSP00000216797	0.900	NF-kappa-B inhibitor alpha
6	9606.ENSP00000226574	0.900	Nuclear factor NF-kappa-B p105 subunit
7	9606.ENSP00000384273	0.900	Transcription factor p65
8	9606.ENSP00000243611	0.871	C4b-binding protein beta chain
9	9606.ENSP00000378130	0.795	Complement factor I
10	9606.ENSP00000255030	0.773	C-reactive protein
11	9606.ENSP00000379682	0.764	Salivary acidic proline-rich phosphoprotein 1/2
12	9606.ENSP00000479168	0.764	Uncharacterized protein
13	9606.ENSP00000246895	0.755	Statherin
14	9606.ENSP00000365891	0.752	Wiskott-Aldrich syndrome protein
15	9606.ENSP00000336931	0.739	Proline-rich nuclear receptor coactivator 1
16	9606.ENSP00000279575	0.737	Basic salivary proline-rich protein 4
17	9606.ENSP00000442626	0.730	Basic salivary proline-rich protein 3
18	9606.ENSP00000245907	0.698	Complement C3
19	9606.ENSP00000255040	0.673	Serum amyloid P-component
20	9606.ENSP00000299367	0.667	Complement C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.800	organic cyclic compound binding
GO:1901363	0.796	heterocyclic compound binding
GO:0003676	0.770	nucleic acid binding
GO:0003723	0.717	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0050789	0.988	regulation of biological process
GO:0048583	0.967	regulation of response to stimulus
GO:0002697	0.926	regulation of immune effector process
GO:0050776	0.910	regulation of immune response
GO:0048518	0.881	positive regulation of biological process
GO:0002920	0.820	regulation of humoral immune response
GO:0048519	0.798	negative regulation of biological process
GO:0050794	0.734	regulation of cellular process
GO:0002683	0.700	negative regulation of immune system process
GO:0048585	0.588	negative regulation of response to stimulus
GO:0030449	0.582	regulation of complement activation
GO:0002819	0.579	regulation of adaptive immune response
GO:0050777	0.567	negative regulation of immune response
GO:0019222	0.537	regulation of metabolic process
GO:0002822	0.522	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0009987	0.509	cellular process
GO:0060255	0.494	regulation of macromolecule metabolic process
GO:0080090	0.483	regulation of primary metabolic process
GO:0051171	0.469	regulation of nitrogen compound metabolic process
GO:0002376	0.418	immune system process
GO:0009605	0.411	response to external stimulus
GO:0002820	0.372	negative regulation of adaptive immune response
GO:0051707	0.369	response to other organism
GO:0009893	0.355	positive regulation of metabolic process
GO:0051246	0.350	regulation of protein metabolic process
GO:0010604	0.350	positive regulation of macromolecule metabolic process
GO:0006955	0.335	immune response
GO:0006950	0.324	response to stress
GO:0048584	0.314	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0005886	0.987	plasma membrane
GO:0072562	0.981	blood microparticle
GO:0043226	0.967	organelle
GO:0043227	0.962	membrane-bounded organelle
GO:0005622	0.906	intracellular anatomical structure
GO:0005737	0.873	cytoplasm
GO:0043229	0.859	intracellular organelle
GO:0070062	0.852	extracellular exosome
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0032991	0.790	protein-containing complex
GO:0099503	0.599	secretory vesicle
GO:0030141	0.594	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]