StarFunc result for job id P04004

User Input

>input (478 residues)
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D9ZGG2	0.587	0.587	5.890E-79	478	1.000	1.000	D9ZGG2.pdb.gz	D9ZGG2_HUMAN Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=4 SV=1
2	AFDB:P29788	0.609	0.609	2.511E-67	478	0.747	0.747	P29788.pdb.gz	VTNC_MOUSE Vitronectin OS=Mus musculus OX=10090 GN=Vtn PE=1 SV=2
3	AFDB:Q7TQ11	0.618	0.604	7.481E-67	490	0.743	0.724	Q7TQ11.pdb.gz	Q7TQ11_RAT Aa1018 OS=Rattus norvegicus OX=10116 GN=Vtn PE=1 SV=1
4	AFDB:P48819	0.670	0.696	1.052E-65	459	0.722	0.752	P48819.pdb.gz	VTNC_PIG Vitronectin OS=Sus scrofa OX=9823 GN=VTN PE=1 SV=1
5	AFDB:Q92954	0.399	0.144	7.386E-21	1404	0.205	0.070	Q92954.pdb.gz	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
6	AFDB:Q9JM99	0.393	0.186	2.615E-20	1054	0.222	0.101	Q9JM99.pdb.gz	PRG4_MOUSE Proteoglycan 4 OS=Mus musculus OX=10090 GN=Prg4 PE=1 SV=2
7	AFDB:P20058	0.332	0.344	1.271E-12	460	0.128	0.133	P20058.pdb.gz	HEMO_RABIT Hemopexin OS=Oryctolagus cuniculus OX=9986 GN=HPX PE=1 SV=2
8	AFDB:A0A0A1HAN6	0.355	0.380	2.391E-12	445	0.121	0.130	A0A0A1HAN6.pdb.gz	A0A0A1HAN6_CARAX Hemopexin OS=Carassius carassius OX=217509 GN=Wap65-1 PE=1 SV=1
9	AFDB:P02790	0.330	0.341	6.726E-12	462	0.132	0.136	P02790.pdb.gz	HEMO_HUMAN Hemopexin OS=Homo sapiens OX=9606 GN=HPX PE=1 SV=2
10	AFDB:Q6PHG2	0.344	0.367	7.991E-12	447	0.121	0.130	Q6PHG2.pdb.gz	HEMO_DANRE Hemopexin OS=Danio rerio OX=7955 GN=hpx PE=2 SV=2
11	PDB:1su3B	0.324	0.370	1.156E-11	416	0.111	0.127	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
12	PDB:1gxdA	0.348	0.271	3.847E-10	624	0.111	0.085	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
13	PDB:3lp9A	0.227	0.457	5.366E-7	227	0.086	0.181	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
14	PDB:6rlbD	0.176	0.186	2.114E-4	446	0.065	0.070	6rlbD.pdb.gz
15	PDB:6lqsBE	0.215	0.138	1.057E-3	823	0.050	0.029	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
16	PDB:7d5sBE	0.166	0.100	1.877E-3	865	0.036	0.020	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:3jb9U	0.163	0.178	3.148E-3	430	0.027	0.030	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	PDB:6kybB	0.167	0.228	3.148E-3	330	0.021	0.030	6kybB.pdb.gz
19	PDB:7d4iBE	0.165	0.097	3.532E-3	890	0.036	0.019	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
20	PDB:3i2nA	0.166	0.216	4.196E-3	345	0.019	0.026	3i2nA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D9ZGG2	0.0	997	478	1.000	1.000	D9ZGG2_HUMAN Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=4 SV=1
2	P04004	0.0	997	478	1.000	1.000	VTNC_HUMAN Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1
3	P29788	0.0	679	478	0.738	0.738	VTNC_MOUSE Vitronectin OS=Mus musculus OX=10090 GN=Vtn PE=1 SV=2
4	P48819	0.0	612	459	0.709	0.739	VTNC_PIG Vitronectin OS=Sus scrofa OX=9823 GN=VTN PE=1 SV=1
5	Q3KR94	0.0	657	478	0.734	0.734	Q3KR94_RAT Vitronectin OS=Rattus norvegicus OX=10116 GN=Vtn PE=2 SV=1
6	Q7TQ11	0.0	644	490	0.734	0.716	Q7TQ11_RAT Aa1018 OS=Rattus norvegicus OX=10116 GN=Vtn PE=1 SV=1
7	F5GX75	3.82e-81	249	118	0.247	1.000	F5GX75_HUMAN Vitronectin (Fragment) OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=2
8	Q9JM99	2.26e-32	133	1054	0.149	0.067	PRG4_MOUSE Proteoglycan 4 OS=Mus musculus OX=10090 GN=Prg4 PE=1 SV=2
9	Q92954	6.52e-30	126	1404	0.138	0.047	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
10	A0A0B4JDA7	5.95e-29	122	554	0.140	0.121	A0A0B4JDA7_DROME Matrix metalloproteinase 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1
11	A0A0B4K7H5	8.02e-29	121	512	0.140	0.131	A0A0B4K7H5_DROME Matrix metalloproteinase 1, isoform J OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1
12	Q9W122	8.15e-29	121	584	0.140	0.115	Q9W122_DROME Matrix metalloproteinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=2 SV=3
13	Q9GTK3	8.51e-29	121	567	0.140	0.118	Q9GTK3_DROME Matrix metalloproteinase 1 OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=2 SV=1
14	A0A0B4JD53	1.07e-28	120	528	0.140	0.127	A0A0B4JD53_DROME Matrix metalloproteinase 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1
15	Q8MLN6	1.07e-28	121	541	0.140	0.124	Q8MLN6_DROME Matrix metalloproteinase 1, isoform D OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=2
16	A0A0B4JCU7	1.20e-28	120	542	0.140	0.124	A0A0B4JCU7_DROME Matrix metalloproteinase 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1
17	Q9WTR0	1.10e-13	75.5	607	0.126	0.099	MMP16_MOUSE Matrix metalloproteinase-16 OS=Mus musculus OX=10090 GN=Mmp16 PE=2 SV=3
18	O35548	1.17e-13	75.5	607	0.130	0.102	MMP16_RAT Matrix metalloproteinase-16 OS=Rattus norvegicus OX=10116 GN=Mmp16 PE=2 SV=1
19	P51512	1.79e-13	75.1	607	0.130	0.102	MMP16_HUMAN Matrix metalloproteinase-16 OS=Homo sapiens OX=9606 GN=MMP16 PE=1 SV=2
20	P53690	1.90e-13	74.7	582	0.134	0.110	MMP14_MOUSE Matrix metalloproteinase-14 OS=Mus musculus OX=10090 GN=Mmp14 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00045 Hemopexin	4.4e-50	178.7	Hemopexin
2	PF01033 Somatomedin_B	3.3e-06	38.7	Somatomedin B domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223095	0.999	Plasminogen activator inhibitor 1
2	9606.ENSP00000261023	0.999	Integrin alpha-V
3	9606.ENSP00000339328	0.999	Urokinase plasminogen activator surface receptor
4	9606.ENSP00000361850	0.999	Urokinase-type plasminogen activator
5	9606.ENSP00000452786	0.996	Integrin beta-3
6	9606.ENSP00000308938	0.991	Plasminogen
7	9606.ENSP00000356671	0.991	Antithrombin-III
8	9606.ENSP00000346839	0.983	Fibronectin type III domain containing
9	9606.ENSP00000262407	0.981	Integrin alpha-IIb
10	9606.ENSP00000478570	0.981	Vascular endothelial growth factor A
11	9606.ENSP00000296181	0.974	Integrin beta-5
12	9606.ENSP00000302665	0.969	Insulin-like growth factor I
13	9606.ENSP00000379350	0.969	Integrin beta-1
14	9606.ENSP00000362680	0.959	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000263923	0.952	Vascular endothelial growth factor receptor 2
16	9606.ENSP00000283249	0.952	Integrin beta-6
17	9606.ENSP00000367316	0.951	Integrin alpha-8
18	9606.ENSP00000225698	0.949	Complement component 1 Q subcomponent-binding protein, mitochondrial
19	9606.ENSP00000379975	0.949	Integrin-linked protein kinase
20	9606.ENSP00000007722	0.948	Integrin alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0005515	0.997	protein binding
GO:0050839	0.823	cell adhesion molecule binding
GO:0005102	0.767	signaling receptor binding
GO:0042802	0.594	identical protein binding
GO:0050840	0.550	extracellular matrix binding
GO:0005539	0.339	glycosaminoglycan binding
GO:1901681	0.335	sulfur compound binding
GO:0008201	0.327	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0032501	0.976	multicellular organismal process
GO:0048856	0.968	anatomical structure development
GO:0007155	0.967	cell adhesion
GO:0048522	0.965	positive regulation of cellular process
GO:0007275	0.959	multicellular organism development
GO:0030155	0.953	regulation of cell adhesion
GO:1903034	0.929	regulation of response to wounding
GO:0051239	0.916	regulation of multicellular organismal process
GO:0050878	0.913	regulation of body fluid levels
GO:0050896	0.912	response to stimulus
GO:0060627	0.910	regulation of vesicle-mediated transport
GO:0048869	0.901	cellular developmental process
GO:0061041	0.901	regulation of wound healing
GO:0042325	0.896	regulation of phosphorylation
GO:0032102	0.888	negative regulation of response to external stimulus
GO:0030193	0.887	regulation of blood coagulation
GO:0031589	0.886	cell-substrate adhesion
GO:0050730	0.885	regulation of peptidyl-tyrosine phosphorylation
GO:0030154	0.882	cell differentiation
GO:0007160	0.874	cell-matrix adhesion
GO:0001704	0.872	formation of primary germ layer
GO:0061045	0.849	negative regulation of wound healing
GO:0051247	0.848	positive regulation of protein metabolic process
GO:0030100	0.842	regulation of endocytosis
GO:0071840	0.837	cellular component organization or biogenesis
GO:0030334	0.837	regulation of cell migration
GO:0048731	0.835	system development
GO:0016043	0.832	cellular component organization
GO:0001706	0.832	endoderm formation
GO:0048584	0.811	positive regulation of response to stimulus
GO:0051241	0.810	negative regulation of multicellular organismal process
GO:0050790	0.793	regulation of catalytic activity
GO:0030162	0.793	regulation of proteolysis
GO:0045785	0.764	positive regulation of cell adhesion
GO:0048523	0.762	negative regulation of cellular process
GO:0035987	0.750	endodermal cell differentiation
GO:0009892	0.747	negative regulation of metabolic process
GO:0010605	0.733	negative regulation of macromolecule metabolic process
GO:0009966	0.729	regulation of signal transduction
GO:1900047	0.712	negative regulation of hemostasis
GO:0050819	0.702	negative regulation of coagulation
GO:1903036	0.668	positive regulation of response to wounding
GO:0040017	0.638	positive regulation of locomotion
GO:0048513	0.594	animal organ development
GO:0010810	0.583	regulation of cell-substrate adhesion
GO:0051248	0.555	negative regulation of protein metabolic process
GO:0048259	0.538	regulation of receptor-mediated endocytosis
GO:0010468	0.527	regulation of gene expression
GO:0051050	0.521	positive regulation of transport
GO:0051130	0.515	positive regulation of cellular component organization
GO:0090303	0.515	positive regulation of wound healing
GO:0030335	0.507	positive regulation of cell migration
GO:0030195	0.499	negative regulation of blood coagulation
GO:0031325	0.477	positive regulation of cellular metabolic process
GO:0010647	0.468	positive regulation of cell communication
GO:0014910	0.464	regulation of smooth muscle cell migration
GO:0045807	0.460	positive regulation of endocytosis
GO:0023056	0.457	positive regulation of signaling
GO:0010811	0.449	positive regulation of cell-substrate adhesion
GO:0006950	0.423	response to stress
GO:0071704	0.399	organic substance metabolic process
GO:0045937	0.385	positive regulation of phosphate metabolic process
GO:0042327	0.377	positive regulation of phosphorylation
GO:0001934	0.367	positive regulation of protein phosphorylation
GO:0044093	0.365	positive regulation of molecular function
GO:0051716	0.329	cellular response to stimulus
GO:0051336	0.326	regulation of hydrolase activity
GO:0044238	0.309	primary metabolic process
GO:0022607	0.307	cellular component assembly
GO:0009967	0.307	positive regulation of signal transduction
GO:0042221	0.304	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0062023	0.997	collagen-containing extracellular matrix
GO:0005576	0.993	extracellular region
GO:0005783	0.970	endoplasmic reticulum
GO:0005615	0.954	extracellular space
GO:0005886	0.908	plasma membrane
GO:0031982	0.889	vesicle
GO:0070013	0.883	intracellular organelle lumen
GO:0070062	0.815	extracellular exosome
GO:0032991	0.483	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]