StarFunc result for job id P04035

User Input

>input (888 residues)
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT
QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI
SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV
LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04035	1.000	1.000	0.000	888	1.000	1.000	P04035.pdb.gz	HMDH_HUMAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Homo sapiens OX=9606 GN=HMGCR PE=1 SV=1
2	AFDB:A0A2R8QHL5	0.581	0.567	1.913E-103	912	0.776	0.755	A0A2R8QHL5.pdb.gz
3	AFDB:A2BGX2	0.518	0.516	1.997E-99	893	0.780	0.776	A2BGX2.pdb.gz
4	AFDB:Q58ER2	0.555	0.582	7.624E-91	845	0.677	0.711	Q58ER2.pdb.gz	Q58ER2_DANRE 3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Danio rerio OX=7955 GN=hmgcr2 PE=2 SV=1
5	AFDB:P14773	0.518	0.501	7.211E-74	920	0.468	0.452	P14773.pdb.gz	HMDH_DROME 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Drosophila melanogaster OX=7227 GN=Hmgcr PE=2 SV=2
6	AFDB:A0A060XC77	0.348	0.381	1.160E-69	804	0.553	0.611	A0A060XC77.pdb.gz	A0A060XC77_ONCMY 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00062333001 PE=3 SV=1
7	AFDB:A0A060XV16	0.293	0.396	1.423E-60	646	0.516	0.709	A0A060XV16.pdb.gz	A0A060XV16_ONCMY hydroxymethylglutaryl-CoA reductase (NADPH) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00016349001 PE=3 SV=1
8	AFDB:A0A1D8PD39	0.481	0.400	5.377E-59	1073	0.382	0.316	A0A1D8PD39.pdb.gz	HMDH_CANAL 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMG1 PE=2 SV=1
9	AFDB:P12683	0.490	0.416	6.254E-57	1054	0.384	0.324	P12683.pdb.gz	HMDH1_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMG1 PE=1 SV=1
10	AFDB:Q10283	0.509	0.433	3.845E-56	1053	0.356	0.300	Q10283.pdb.gz	HMDH_SCHPO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmg1 PE=1 SV=2
11	PDB:7uliAAA	0.402	0.939	1.347E-38	377	0.241	0.568	7uliAAA.pdb.gz
12	PDB:6tbuA	0.140	0.147	2.458E-2	842	0.033	0.034	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
13	PDB:6v3fA	0.165	0.123	2.458E-2	1234	0.041	0.029	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
14	PDB:1lgrA	0.096	0.143	2.799E-2	445	0.044	0.088	1lgrA.pdb.gz	Interactions of nucleotides with fully unadenylylated glutamine synthetase from Salmonella typhimurium.
15	PDB:7w85A	0.089	0.151	3.327E-2	435	0.041	0.083	7w85A.pdb.gz
16	PDB:1f1hA	0.089	0.129	6.095E-2	468	0.048	0.092	1f1hA.pdb.gz	The crystal structure of phosphinothricin in the active site of glutamine synthetase illuminates the mechanism of enzymatic inhibition.
17	PDB:1r3fA	0.074	0.177	9.807E-2	278	0.026	0.083	1r3fA.pdb.gz
18	PDB:7n6bA	0.129	0.148	1.271E-1	757	0.037	0.044	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
19	PDB:6dmyA	0.139	0.126	1.511E-1	992	0.043	0.038	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
20	PDB:7e2iD	0.143	0.141	1.511E-1	907	0.037	0.036	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060XC77	0.0	966	804	0.559	0.617	A0A060XC77_ONCMY 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00062333001 PE=3 SV=1
2	A0A060XV16	0.0	909	646	0.523	0.718	A0A060XV16_ONCMY hydroxymethylglutaryl-CoA reductase (NADPH) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00016349001 PE=3 SV=1
3	A9JSZ0	0.0	1436	884	0.779	0.783	A9JSZ0_DANRE 3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Danio rerio OX=7955 GN=hmgcr1 PE=2 SV=1
4	P00347	0.0	1714	887	0.932	0.933	HMDH_CRIGR 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Cricetulus griseus OX=10029 GN=HMGCR PE=1 SV=1
5	P04035	0.0	1837	888	1.000	1.000	HMDH_HUMAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Homo sapiens OX=9606 GN=HMGCR PE=1 SV=1
6	P14773	0.0	771	920	0.482	0.465	HMDH_DROME 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Drosophila melanogaster OX=7227 GN=Hmgcr PE=2 SV=2
7	P51639	0.0	1711	887	0.928	0.929	HMDH_RAT 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Rattus norvegicus OX=10116 GN=Hmgcr PE=1 SV=2
8	Q01237	0.0	1720	887	0.935	0.936	HMDH_MOUSE 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Mus musculus OX=10090 GN=Hmgcr PE=1 SV=3
9	Q58ER2	0.0	1187	845	0.682	0.717	Q58ER2_DANRE 3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Danio rerio OX=7955 GN=hmgcr2 PE=2 SV=1
10	A0A1D8PD39	1.04e-170	526	1073	0.292	0.241	HMDH_CANAL 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMG1 PE=2 SV=1
11	P12683	1.84e-164	509	1054	0.288	0.243	HMDH1_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMG1 PE=1 SV=1
12	P12684	1.20e-162	504	1045	0.284	0.241	HMDH2_YEAST 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMG2 PE=1 SV=1
13	Q4WHZ1	1.21e-162	506	1130	0.292	0.229	HMDH1_ASPFU 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hmg1 PE=1 SV=1
14	P14891	4.38e-161	485	592	0.267	0.400	HMDH1_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 OS=Arabidopsis thaliana OX=3702 GN=HMG1 PE=1 SV=1
15	A0A0A1C930	4.37e-160	483	594	0.265	0.396	HMR2A_PANGI 3-hydroxy-3-methylglutaryl coenzyme A reductase 2-A OS=Panax ginseng OX=4054 GN=HMGR2 PE=2 SV=1
16	Q10283	1.21e-157	491	1053	0.286	0.241	HMDH_SCHPO 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hmg1 PE=1 SV=2
17	A0A0A1C3I2	5.94e-157	474	573	0.271	0.421	HMGR1_PANGI 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 OS=Panax ginseng OX=4054 GN=HMGR1 PE=2 SV=1
18	P43256	6.99e-156	471	562	0.267	0.422	HMDH2_ARATH 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 OS=Arabidopsis thaliana OX=3702 GN=HMG2 PE=2 SV=1
19	C8VN86	1.29e-154	462	416	0.261	0.558	PBCC_EMENI 3-hydroxy-3-methylglutaryl coenzyme A reductase AN1593 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN1593 PE=2 SV=1
20	Q9Y0F3	1.05e-144	437	434	0.247	0.505	Q9Y0F3_LEIMA 3-hydroxy-3-methylglutaryl coenzyme A reductase OS=Leishmania major OX=5664 GN=hmgr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00368 HMG-CoA_red	8.6e-140	477.5	Hydroxymethylglutaryl-coenzyme A reductase
2	PF02460 Patched	6.3e-05	33.0	Patched family
3	PF12349 Sterol-sensing	1.7e-13	62.2	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322706	0.999	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
2	9606.ENSP00000443551	0.995	Mevalonate kinase
3	9606.ENSP00000344741	0.993	Insulin-induced gene 1 protein
4	9606.ENSP00000265896	0.992	Squalene monooxygenase
5	9606.ENSP00000354476	0.992	Sterol regulatory element-binding protein 2
6	9606.ENSP00000348069	0.988	Sterol regulatory element-binding protein 1
7	9606.ENSP00000358414	0.988	Hydroxymethylglutaryl-CoA synthase, mitochondrial
8	9606.ENSP00000370748	0.982	Isopentenyl-diphosphate Delta-isomerase 1
9	9606.ENSP00000003100	0.978	Lanosterol 14-alpha demethylase
10	9606.ENSP00000261507	0.972	Methylsterol monooxygenase 1
11	9606.ENSP00000385523	0.966	Peroxisome proliferator-activated receptor alpha
12	9606.ENSP00000349078	0.945	Farnesyl pyrophosphate synthase
13	9606.ENSP00000301012	0.940	Diphosphomevalonate decarboxylase
14	9606.ENSP00000262188	0.936	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
15	9606.ENSP00000480828	0.933	Squalene synthase
16	9606.ENSP00000419692	0.929	Retinoic acid receptor RXR-alpha
17	9606.ENSP00000325690	0.913	Histone-arginine methyltransferase CARM1
18	9606.ENSP00000217964	0.912	F-box-like/WD repeat-containing protein TBL1X
19	9606.ENSP00000262367	0.912	CREB-binding protein
20	9606.ENSP00000242480	0.911	E3 SUMO-protein ligase EGR2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004420	1.000	hydroxymethylglutaryl-CoA reductase (NADPH) activity
GO:0097159	0.972	organic cyclic compound binding
GO:0036094	0.949	small molecule binding
GO:1901363	0.926	heterocyclic compound binding
GO:0043167	0.713	ion binding
GO:0000166	0.690	nucleotide binding
GO:0017076	0.676	purine nucleotide binding
GO:0097367	0.667	carbohydrate derivative binding
GO:0030554	0.656	adenyl nucleotide binding
GO:0043168	0.651	anion binding
GO:0032553	0.632	ribonucleotide binding
GO:0032555	0.611	purine ribonucleotide binding
GO:0032559	0.561	adenyl ribonucleotide binding
GO:0050661	0.523	NADP binding
GO:0070402	0.512	NADPH binding
GO:0120225	0.309	coenzyme A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:0008202	0.866	steroid metabolic process
GO:1901615	0.864	organic hydroxy compound metabolic process
GO:0016125	0.852	sterol metabolic process
GO:1902652	0.813	secondary alcohol metabolic process
GO:1901617	0.805	organic hydroxy compound biosynthetic process
GO:0006694	0.788	steroid biosynthetic process
GO:0044283	0.771	small molecule biosynthetic process
GO:0009987	0.730	cellular process
GO:0008203	0.711	cholesterol metabolic process
GO:0065007	0.710	biological regulation
GO:0016126	0.706	sterol biosynthetic process
GO:0044237	0.586	cellular metabolic process
GO:0046165	0.564	alcohol biosynthetic process
GO:0050789	0.512	regulation of biological process
GO:0050794	0.418	regulation of cellular process
GO:1902653	0.396	secondary alcohol biosynthetic process
GO:0006807	0.314	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0098588	0.402	bounding membrane of organelle
GO:0005777	0.302	peroxisome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15989	1.000	(R)-mevalonate + CoA + 2 NADP(+) = (3S)-hydroxy-3-methylglutaryl-CoA + 2 H(+) + 2 NADPH
EC:1.1.1.34	1.000	hydroxymethylglutaryl-CoA reductase (NADPH).

[back to server]