StarFunc result for job id P04070

User Input

>input (461 residues)
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04070	1.000	1.000	1.007E-96	461	1.000	1.000	P04070.pdb.gz	PROC_HUMAN Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1
2	AFDB:P33587	0.848	0.850	3.381E-72	460	0.683	0.685	P33587.pdb.gz	PROC_MOUSE Vitamin K-dependent protein C OS=Mus musculus OX=10090 GN=Proc PE=1 SV=2
3	AFDB:P31394	0.809	0.809	1.443E-70	461	0.685	0.685	P31394.pdb.gz	PROC_RAT Vitamin K-dependent protein C OS=Rattus norvegicus OX=10116 GN=Proc PE=2 SV=1
4	AFDB:P00742	0.636	0.602	2.901E-48	488	0.373	0.352	P00742.pdb.gz	FA10_HUMAN Coagulation factor X OS=Homo sapiens OX=9606 GN=F10 PE=1 SV=2
5	AFDB:Q63207	0.601	0.575	1.073E-47	482	0.380	0.363	Q63207.pdb.gz	FA10_RAT Coagulation factor X OS=Rattus norvegicus OX=10116 GN=F10 PE=2 SV=1
6	AFDB:F1QLC3	0.618	0.567	8.799E-47	504	0.377	0.345	F1QLC3.pdb.gz	F1QLC3_DANRE Coagulation factor X OS=Danio rerio OX=7955 GN=fi12c10 PE=4 SV=1
7	AFDB:P81428	0.595	0.602	2.382E-45	455	0.349	0.354	P81428.pdb.gz	FAXD_TROCA Venom prothrombin activator trocarin-D OS=Tropidechis carinatus OX=100989 PE=1 SV=2
8	AFDB:F1QFP3	0.623	0.661	4.853E-44	433	0.369	0.393	F1QFP3.pdb.gz
9	AFDB:Q56VR3	0.593	0.585	5.137E-44	467	0.358	0.353	Q56VR3.pdb.gz	FAXC_PSETE Venom prothrombin activator pseutarin-C catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=2
10	AFDB:P16294	0.593	0.581	6.093E-44	471	0.351	0.344	P16294.pdb.gz	FA9_MOUSE Coagulation factor IX OS=Mus musculus OX=10090 GN=F9 PE=2 SV=3
11	PDB:4bxwB	0.569	0.902	8.560E-29	287	0.221	0.355	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	PDB:5edmA	0.477	0.403	1.078E-24	550	0.310	0.260	5edmA.pdb.gz	How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
13	PDB:2a31A	0.464	0.940	2.258E-24	223	0.184	0.381	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
14	PDB:4bnrA	0.466	0.887	2.390E-24	237	0.167	0.325	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
15	PDB:6qfgA	0.450	0.901	3.000E-24	223	0.197	0.408	6qfgA.pdb.gz	Evaluation of a crystallographic surrogate for kallikrein 5 in the discovery of novel inhibitors for Netherton syndrome.
16	PDB:2ra3A	0.467	0.947	7.889E-24	224	0.165	0.339	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
17	PDB:1npmA	0.455	0.921	2.324E-23	223	0.167	0.345	1npmA.pdb.gz
18	PDB:5ms3A	0.457	0.907	2.324E-23	228	0.182	0.368	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
19	PDB:1cgiE	0.473	0.873	2.757E-23	245	0.178	0.335	1cgiE.pdb.gz
20	PDB:2a7jA	0.467	0.879	2.757E-23	240	0.165	0.317	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04070	0.0	953	461	1.000	1.000	PROC_HUMAN Vitamin K-dependent protein C OS=Homo sapiens OX=9606 GN=PROC PE=1 SV=1
2	P31394	0.0	673	461	0.690	0.690	PROC_RAT Vitamin K-dependent protein C OS=Rattus norvegicus OX=10116 GN=Proc PE=2 SV=1
3	P33587	0.0	665	460	0.692	0.693	PROC_MOUSE Vitamin K-dependent protein C OS=Mus musculus OX=10090 GN=Proc PE=1 SV=2
4	Q63207	1.38e-105	324	482	0.375	0.359	FA10_RAT Coagulation factor X OS=Rattus norvegicus OX=10116 GN=F10 PE=2 SV=1
5	P00742	7.19e-100	309	488	0.360	0.340	FA10_HUMAN Coagulation factor X OS=Homo sapiens OX=9606 GN=F10 PE=1 SV=2
6	P83370	2.02e-99	307	455	0.373	0.378	FAXD_HOPST Venom prothrombin activator hopsarin-D OS=Hoplocephalus stephensii OX=196418 PE=1 SV=2
7	P82807	1.36e-98	305	455	0.367	0.371	FAXD1_NOTSC Venom prothrombin activator notecarin-D1 OS=Notechis scutatus scutatus OX=70142 PE=1 SV=2
8	P08709	1.84e-98	305	466	0.380	0.376	FA7_HUMAN Coagulation factor VII OS=Homo sapiens OX=9606 GN=F7 PE=1 SV=1
9	Q58L95	4.35e-98	304	467	0.367	0.362	FAXC_OXYMI Venom prothrombin activator omicarin-C catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
10	Q58L96	7.45e-98	303	467	0.367	0.362	FAXC_OXYSU Venom prothrombin activator oscutarin-C catalytic subunit OS=Oxyuranus scutellatus OX=8668 PE=1 SV=1
11	P81428	9.35e-98	303	455	0.358	0.363	FAXD_TROCA Venom prothrombin activator trocarin-D OS=Tropidechis carinatus OX=100989 PE=1 SV=2
12	Q8K3U6	2.08e-97	301	446	0.384	0.397	FA7_RAT Coagulation factor VII OS=Rattus norvegicus OX=10116 GN=F7 PE=2 SV=1
13	Q56VR3	3.74e-97	301	467	0.367	0.362	FAXC_PSETE Venom prothrombin activator pseutarin-C catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=2
14	Q58L94	1.48e-95	297	453	0.356	0.362	FAXD2_NOTSC Venom prothrombin activator notecarin-D2 OS=Notechis scutatus scutatus OX=70142 PE=1 SV=1
15	F1QLC3	8.32e-95	297	504	0.382	0.349	F1QLC3_DANRE Coagulation factor X OS=Danio rerio OX=7955 GN=fi12c10 PE=4 SV=1
16	Q504H3	9.24e-95	294	433	0.382	0.406	Q504H3_DANRE Coagulation factor VII OS=Danio rerio OX=7955 GN=wu:fb59f04 PE=2 SV=1
17	P70375	2.86e-94	293	446	0.371	0.383	FA7_MOUSE Coagulation factor VII OS=Mus musculus OX=10090 GN=F7 PE=1 SV=1
18	P00740	3.26e-89	281	461	0.345	0.345	FA9_HUMAN Coagulation factor IX OS=Homo sapiens OX=9606 GN=F9 PE=1 SV=2
19	P16294	1.60e-87	277	471	0.349	0.342	FA9_MOUSE Coagulation factor IX OS=Mus musculus OX=10090 GN=F9 PE=2 SV=3
20	P16296	2.18e-87	276	462	0.349	0.348	FA9_RAT Coagulation factor IX OS=Rattus norvegicus OX=10116 GN=F9 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	14	17.0	Complement Clr-like EGF-like
2	PF09342 DUF1986	0.35	22.7	Domain of unknown function (DUF1986)
3	PF00008 EGF	0.16	23.6	EGF-like domain
4	PF07974 EGF_2	92	14.8	EGF-like domain
5	PF14670 FXa_inhibition	1.3e-08	46.3	Coagulation Factor Xa inhibitory site
6	PF00594 Gla	9.9e-14	62.6	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
7	PF12661 hEGF	0.15	24.0	Human growth factor-like EGF
8	PF00089 Trypsin	1.9e-66	235.6	Trypsin
9	PF13365 Trypsin_2	0.055	25.9	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216968	0.998	Endothelial protein C receptor
2	9606.ENSP00000308541	0.994	Prothrombin
3	9606.ENSP00000366307	0.983	Thrombomodulin
4	9606.ENSP00000356671	0.976	Antithrombin-III
5	9606.ENSP00000353393	0.971	Coagulation factor VIII
6	9606.ENSP00000306361	0.964	Fibrinogen alpha chain
7	9606.ENSP00000233838	0.961	Vitamin K-dependent gamma-carboxylase
8	9606.ENSP00000384957	0.957	Coagulation factor XI
9	9606.ENSP00000333203	0.953	Plasma serine protease inhibitor
10	9606.ENSP00000321326	0.952	Proteinase-activated receptor 1
11	9606.ENSP00000336829	0.951	Fibrinogen gamma chain
12	9606.ENSP00000261405	0.948	Von Willebrand factor
13	9606.ENSP00000356771	0.948	Coagulation factor V
14	9606.ENSP00000377783	0.947	Vitamin K-dependent protein S
15	9606.ENSP00000306099	0.941	Fibrinogen beta chain
16	9606.ENSP00000296029	0.935	Platelet factor 4
17	9606.ENSP00000356382	0.935	Coagulation factor XIII B chain
18	9606.ENSP00000483552	0.935	Furin
19	9606.ENSP00000329380	0.926	Platelet glycoprotein Ib alpha chain
20	9606.ENSP00000321853	0.925	Alpha-2-antiplasmin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	1.000	endopeptidase activity
GO:0008236	1.000	serine-type peptidase activity
GO:0005515	0.998	protein binding
GO:0004252	0.988	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1903034	0.995	regulation of response to wounding
GO:1900046	0.995	regulation of hemostasis
GO:0051241	0.991	negative regulation of multicellular organismal process
GO:0048585	0.989	negative regulation of response to stimulus
GO:0030193	0.989	regulation of blood coagulation
GO:1900047	0.985	negative regulation of hemostasis
GO:0030195	0.981	negative regulation of blood coagulation
GO:0032501	0.680	multicellular organismal process
GO:0071704	0.660	organic substance metabolic process
GO:0006807	0.654	nitrogen compound metabolic process
GO:0048518	0.643	positive regulation of biological process
GO:0044238	0.630	primary metabolic process
GO:1901564	0.615	organonitrogen compound metabolic process
GO:0050794	0.609	regulation of cellular process
GO:0043170	0.587	macromolecule metabolic process
GO:0019538	0.537	protein metabolic process
GO:0050896	0.425	response to stimulus
GO:0009987	0.371	cellular process
GO:0048523	0.346	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0012505	0.995	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0005737	0.985	cytoplasm
GO:0032991	0.983	protein-containing complex
GO:0031982	0.915	vesicle
GO:1903561	0.906	extracellular vesicle
GO:0005783	0.892	endoplasmic reticulum
GO:0070062	0.890	extracellular exosome
GO:0071944	0.887	cell periphery
GO:0005788	0.807	endoplasmic reticulum lumen
GO:0016020	0.684	membrane
GO:1905286	0.444	serine-type peptidase complex
GO:1905369	0.421	endopeptidase complex
GO:0005796	0.415	Golgi lumen
GO:0005886	0.330	plasma membrane
GO:1905370	0.324	serine-type endopeptidase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.988	Serine endopeptidases.

[back to server]