StarFunc result for job id P04080

User Input

>input (98 residues)
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG
DEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04080	1.000	1.000	2.137E-17	98	1.000	1.000	P04080.pdb.gz	CYTB_HUMAN Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2
2	PDB:1stfI	0.980	0.980	5.114E-16	98	0.980	0.980	1stfI.pdb.gz
3	AFDB:Q62426	0.994	0.994	5.778E-15	98	0.786	0.786	Q62426.pdb.gz	CYTB_MOUSE Cystatin-B OS=Mus musculus OX=10090 GN=Cstb PE=1 SV=1
4	AFDB:P01041	0.993	0.993	7.604E-15	98	0.786	0.786	P01041.pdb.gz	CYTB_RAT Cystatin-B OS=Rattus norvegicus OX=10116 GN=Cstb PE=1 SV=1
5	AFDB:P01040	0.972	0.972	1.567E-11	98	0.531	0.531	P01040.pdb.gz	CYTA_HUMAN Cystatin-A OS=Homo sapiens OX=9606 GN=CSTA PE=1 SV=1
6	AFDB:J7FQE8	0.968	0.949	1.656E-11	100	0.469	0.460	J7FQE8.pdb.gz	CYTB_OPLFA Cystatin-B OS=Oplegnathus fasciatus OX=163134 PE=2 SV=1
7	AFDB:P35174	0.936	0.892	3.380E-11	103	0.531	0.505	P35174.pdb.gz	CYT2_MOUSE Stefin-2 OS=Mus musculus OX=10090 GN=Stfa2 PE=3 SV=2
8	AFDB:B2Z449	0.974	0.974	5.541E-11	98	0.439	0.439	B2Z449.pdb.gz	CYTB_PAROL Cystatin-B OS=Paralichthys olivaceus OX=8255 PE=1 SV=1
9	PDB:1nb3I	0.970	0.970	2.850E-10	98	0.531	0.531	1nb3I.pdb.gz	Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
10	AFDB:P35175	0.954	0.964	3.210E-10	97	0.490	0.495	P35175.pdb.gz	CYT1_MOUSE Stefin-1 OS=Mus musculus OX=10090 GN=Stfa1 PE=3 SV=1
11	AFDB:G8IIS4	0.921	0.939	9.656E-9	96	0.337	0.344	G8IIS4.pdb.gz	G8IIS4_ACACA Cysteine protease inhibitor OS=Acanthamoeba castellanii OX=5755 GN=Cyt PE=2 SV=1
12	AFDB:Q5R1U3	0.909	0.947	4.491E-8	94	0.378	0.394	Q5R1U3.pdb.gz	CYTA3_DICDI Cystatin-A3 OS=Dictyostelium discoideum OX=44689 GN=cpiC PE=3 SV=1
13	PDB:4n6mA	0.615	0.528	2.480E-2	117	0.173	0.145	4n6mA.pdb.gz
14	PDB:1yvbI	0.619	0.557	3.448E-2	111	0.224	0.198	1yvbI.pdb.gz
15	PDB:3lh4A	0.607	0.529	3.643E-2	115	0.153	0.130	3lh4A.pdb.gz
16	PDB:2ch9A	0.485	0.401	5.349E-2	126	0.133	0.103	2ch9A.pdb.gz	Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
17	PDB:6rpvA	0.471	0.406	7.436E-2	120	0.194	0.158	6rpvA.pdb.gz
18	PDB:1rn7A	0.598	0.535	1.604E-1	112	0.204	0.179	1rn7A.pdb.gz
19	PDB:6uioA	0.449	0.407	2.488E-1	112	0.133	0.116	6uioA.pdb.gz	Maturation of the functional mouse CRES amyloid from globular form.
20	PDB:3j4qA	0.155	0.084	1.442	230	0.102	0.043	3j4qA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04080	3.77e-70	206	98	1.000	1.000	CYTB_HUMAN Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2
2	Q76LA1	3.77e-70	206	98	1.000	1.000	Q76LA1_HUMAN CSTB protein OS=Homo sapiens OX=9606 GN=CSTB PE=2 SV=1
3	Q62426	2.87e-54	165	98	0.786	0.786	CYTB_MOUSE Cystatin-B OS=Mus musculus OX=10090 GN=Cstb PE=1 SV=1
4	P01041	7.06e-54	164	98	0.786	0.786	CYTB_RAT Cystatin-B OS=Rattus norvegicus OX=10116 GN=Cstb PE=1 SV=1
5	P01040	4.53e-33	112	98	0.531	0.531	CYTA_HUMAN Cystatin-A OS=Homo sapiens OX=9606 GN=CSTA PE=1 SV=1
6	P35174	8.33e-31	106	103	0.531	0.505	CYT2_MOUSE Stefin-2 OS=Mus musculus OX=10090 GN=Stfa2 PE=3 SV=2
7	J7FQE8	6.19e-28	99.4	100	0.469	0.460	CYTB_OPLFA Cystatin-B OS=Oplegnathus fasciatus OX=163134 PE=2 SV=1
8	P35175	1.41e-23	88.2	97	0.490	0.495	CYT1_MOUSE Stefin-1 OS=Mus musculus OX=10090 GN=Stfa1 PE=3 SV=1
9	B2Z449	3.14e-23	87.4	98	0.439	0.439	CYTB_PAROL Cystatin-B OS=Paralichthys olivaceus OX=8255 PE=1 SV=1
10	G8IIS4	1.22e-16	70.5	96	0.337	0.344	G8IIS4_ACACA Cysteine protease inhibitor OS=Acanthamoeba castellanii OX=5755 GN=Cyt PE=2 SV=1
11	Q5R1U3	2.00e-14	64.7	94	0.357	0.372	CYTA3_DICDI Cystatin-A3 OS=Dictyostelium discoideum OX=44689 GN=cpiC PE=3 SV=1
12	Q65YR7	6.41e-13	60.8	95	0.327	0.337	CYTA2_DICDI Cystatin-A2 OS=Dictyostelium discoideum OX=44689 GN=cpiB PE=2 SV=1
13	Q65YR8	4.43e-06	43.5	94	0.245	0.255	CYTA1_DICDI Cystatin-A1 OS=Dictyostelium discoideum OX=44689 GN=cpiA PE=2 SV=1
14	Q41916	1.1	29.6	122	0.143	0.115	CYT5_ARATH Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2
15	P21460	2.2	28.9	140	0.173	0.121	CYTC_MOUSE Cystatin-C OS=Mus musculus OX=10090 GN=Cst3 PE=1 SV=2
16	P14841	2.8	28.5	140	0.163	0.114	CYTC_RAT Cystatin-C OS=Rattus norvegicus OX=10116 GN=Cst3 PE=1 SV=2
17	O35516	3.1	28.9	2473	0.102	0.004	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
18	Q9JM84	3.1	28.5	148	0.102	0.068	CST10_MOUSE Cystatin 10 OS=Mus musculus OX=10090 GN=Cst10 PE=1 SV=1
19	P01034	4.0	28.1	146	0.102	0.068	CYTC_HUMAN Cystatin-C OS=Homo sapiens OX=9606 GN=CST3 PE=1 SV=1
20	Q70DX9	5.5	28.1	644	0.163	0.025	SED1_ASPFU Tripeptidyl-peptidase sed1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sed1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00031 Cystatin	1.6e-20	84.5	Cystatin domain
2	PF01221 Dynein_light	57	15.5	Dynein light chain type 1
3	PF16845 SQAPI	58	15.5	Aspartic acid proteinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345672	0.966	Cathepsin B
2	9606.ENSP00000345344	0.956	Cathepsin L1
3	9606.ENSP00000339145	0.891	Ribosomal RNA processing protein 1 homolog B
4	9606.ENSP00000381448	0.823	Cystatin-C
5	9606.ENSP00000220166	0.787	Pro-cathepsin H
6	9606.ENSP00000345179	0.764	Apolipoprotein D
7	9606.ENSP00000417464	0.764	Ribosomal RNA processing protein 1 homolog A
8	9606.ENSP00000313967	0.761	Complement C1q subcomponent subunit B
9	9606.ENSP00000217423	0.759	Cystatin-S
10	9606.ENSP00000245185	0.746	Metallothionein-2
11	9606.ENSP00000291574	0.740	Trafficking protein particle complex subunit 10
12	9606.ENSP00000345064	0.739	Prickle-like protein 1
13	9606.ENSP00000354394	0.735	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000476960	0.700	Histone cluster 2 H3 pseudogene 2
15	9606.ENSP00000307540	0.675	Cystatin-SA
16	9606.ENSP00000305731	0.668	Cystatin-SN
17	9606.ENSP00000307132	0.664	Cystatin-D
18	9606.ENSP00000264896	0.648	Lysosome membrane protein 2
19	9606.ENSP00000345464	0.645	E3 ubiquitin-protein ligase NHLRC1
20	9606.ENSP00000373648	0.640	Potassium voltage-gated channel subfamily KQT member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004869	1.000	cysteine-type endopeptidase inhibitor activity
GO:0002020	0.997	protease binding
GO:0097159	0.951	organic cyclic compound binding
GO:1901363	0.909	heterocyclic compound binding
GO:0003676	0.875	nucleic acid binding
GO:0003723	0.621	RNA binding
GO:0042802	0.434	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.987	regulation of metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0080090	0.978	regulation of primary metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0030162	0.973	regulation of proteolysis
GO:0048519	0.940	negative regulation of biological process
GO:0065009	0.938	regulation of molecular function
GO:0008152	0.910	metabolic process
GO:0010605	0.904	negative regulation of macromolecule metabolic process
GO:0051172	0.895	negative regulation of nitrogen compound metabolic process
GO:0009987	0.889	cellular process
GO:0050790	0.874	regulation of catalytic activity
GO:0071704	0.824	organic substance metabolic process
GO:0051248	0.802	negative regulation of protein metabolic process
GO:0044238	0.788	primary metabolic process
GO:0051336	0.761	regulation of hydrolase activity
GO:0006807	0.746	nitrogen compound metabolic process
GO:0044092	0.740	negative regulation of molecular function
GO:0045861	0.708	negative regulation of proteolysis
GO:0043170	0.649	macromolecule metabolic process
GO:0043086	0.626	negative regulation of catalytic activity
GO:0052547	0.580	regulation of peptidase activity
GO:1901564	0.554	organonitrogen compound metabolic process
GO:0050896	0.505	response to stimulus
GO:0071840	0.478	cellular component organization or biogenesis
GO:0051346	0.462	negative regulation of hydrolase activity
GO:0016043	0.445	cellular component organization
GO:0050794	0.440	regulation of cellular process
GO:0010466	0.430	negative regulation of peptidase activity
GO:0019538	0.335	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0005829	0.998	cytosol
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0031981	0.990	nuclear lumen
GO:0012505	0.988	endomembrane system
GO:0005576	0.980	extracellular region
GO:0071944	0.970	cell periphery
GO:0005615	0.904	extracellular space
GO:0070062	0.872	extracellular exosome
GO:0005730	0.857	nucleolus
GO:0031012	0.802	extracellular matrix
GO:0062023	0.785	collagen-containing extracellular matrix
GO:0031410	0.785	cytoplasmic vesicle
GO:0030141	0.707	secretory granule
GO:0016020	0.508	membrane
GO:0101002	0.357	ficolin-1-rich granule
GO:0070820	0.348	tertiary granule
GO:0034774	0.348	secretory granule lumen
GO:1904724	0.322	tertiary granule lumen
GO:1904813	0.317	ficolin-1-rich granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]