StarFunc result for job id P04090

User Input

>input (185 residues)
MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLK
DSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRS
LARFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04090	1.000	1.000	2.117E-29	185	1.000	1.000	P04090.pdb.gz	REL2_HUMAN Prorelaxin H2 OS=Homo sapiens OX=9606 GN=RLN2 PE=1 SV=1
2	AFDB:P04808	0.571	0.571	5.570E-22	185	0.822	0.822	P04808.pdb.gz	REL1_HUMAN Prorelaxin H1 OS=Homo sapiens OX=9606 GN=RLN1 PE=1 SV=1
3	AFDB:P01347	0.528	0.525	7.772E-14	186	0.486	0.484	P01347.pdb.gz	REL1_RAT Prorelaxin 1 OS=Rattus norvegicus OX=10116 GN=Rln1 PE=1 SV=1
4	AFDB:P47932	0.498	0.498	1.417E-11	185	0.476	0.476	P47932.pdb.gz	REL1_MOUSE Prorelaxin 1 OS=Mus musculus OX=10090 GN=Rln1 PE=1 SV=1
5	AFDB:Q9QY05	0.292	0.285	2.951E-5	191	0.281	0.272	Q9QY05.pdb.gz	INSL6_MOUSE Insulin-like peptide INSL6 OS=Mus musculus OX=10090 GN=Insl6 PE=2 SV=1
6	AFDB:B1AC67	0.212	0.205	4.553E-4	192	0.205	0.198	B1AC67.pdb.gz	B1AC67_CHICK Relaxin 3 OS=Gallus gallus OX=9031 GN=RFLB PE=2 SV=1
7	AFDB:Q9Y5Q6	0.301	0.389	4.404E-3	135	0.189	0.259	Q9Y5Q6.pdb.gz	INSL5_HUMAN Insulin-like peptide INSL5 OS=Homo sapiens OX=9606 GN=INSL5 PE=1 SV=2
8	AFDB:Q05166	0.131	0.052	1.369	528	0.114	0.040	Q05166.pdb.gz	NUP59_YEAST Nucleoporin ASM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASM4 PE=1 SV=1
9	PDB:7d4iBE	0.115	0.037	2.209	890	0.114	0.024	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
10	PDB:7d4iRJ	0.126	0.036	3.085	738	0.092	0.023	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
11	AFDB:Q28619	0.114	0.070	3.486	358	0.081	0.042	Q28619.pdb.gz	NHRF1_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Oryctolagus cuniculus OX=9986 GN=NHERF1 PE=1 SV=3
12	AFDB:Q96I24	0.138	0.060	3.486	572	0.135	0.044	Q96I24.pdb.gz	FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2
13	PDB:7kzmD	0.110	0.056	4.921	456	0.081	0.033	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
14	PDB:6i9r9	0.094	0.118	5.624	124	0.103	0.153	6i9r9.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
15	PDB:3bicA	0.118	0.045	6.012	715	0.076	0.020	3bicA.pdb.gz
16	PDB:4v88Ah	0.134	0.153	6.427	159	0.092	0.107	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
17	PDB:7d63RJ	0.115	0.042	6.427	796	0.092	0.021	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
18	PDB:7ajtCL	0.116	0.040	6.871	781	0.103	0.024	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:6qw64A	0.111	0.090	7.345	239	0.065	0.050	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:7o9k6	0.080	0.046	7.345	331	0.059	0.033	7o9k6.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04090	2.15e-137	382	185	1.000	1.000	REL2_HUMAN Prorelaxin H2 OS=Homo sapiens OX=9606 GN=RLN2 PE=1 SV=1
2	P04808	1.81e-110	314	185	0.822	0.822	REL1_HUMAN Prorelaxin H1 OS=Homo sapiens OX=9606 GN=RLN1 PE=1 SV=1
3	P01348	1.44e-60	188	182	0.551	0.560	RELX_PIG Prorelaxin OS=Sus scrofa OX=9823 GN=RLN PE=1 SV=1
4	P01347	3.33e-51	164	186	0.438	0.435	REL1_RAT Prorelaxin 1 OS=Rattus norvegicus OX=10116 GN=Rln1 PE=1 SV=1
5	P47932	7.68e-48	155	185	0.427	0.427	REL1_MOUSE Prorelaxin 1 OS=Mus musculus OX=10090 GN=Rln1 PE=1 SV=1
6	Q9QY05	1.30e-06	48.9	191	0.216	0.209	INSL6_MOUSE Insulin-like peptide INSL6 OS=Mus musculus OX=10090 GN=Insl6 PE=2 SV=1
7	B1AC67	2.95e-06	47.8	192	0.232	0.224	B1AC67_CHICK Relaxin 3 OS=Gallus gallus OX=9031 GN=RFLB PE=2 SV=1
8	Q14641	2.15e-05	44.7	139	0.184	0.245	INSL4_HUMAN Early placenta insulin-like peptide OS=Homo sapiens OX=9606 GN=INSL4 PE=1 SV=1
9	Q8BFS3	6.73e-05	43.1	140	0.189	0.250	REL3_RAT Relaxin-3 OS=Rattus norvegicus OX=10116 GN=Rln3 PE=2 SV=1
10	Q8WXF3	0.001	40.0	142	0.178	0.232	REL3_HUMAN Relaxin-3 OS=Homo sapiens OX=9606 GN=RLN3 PE=1 SV=1
11	Q8CHK2	0.006	37.7	141	0.168	0.220	REL3_MOUSE Relaxin-3 OS=Mus musculus OX=10090 GN=Rln3 PE=2 SV=1
12	Q9WUK0	0.037	35.4	128	0.184	0.266	INSL3_RAT Insulin-like 3 OS=Rattus norvegicus OX=10116 GN=Insl3 PE=2 SV=2
13	Q9Y5Q6	0.18	33.5	135	0.108	0.148	INSL5_HUMAN Insulin-like peptide INSL5 OS=Homo sapiens OX=9606 GN=INSL5 PE=1 SV=2
14	F4IPA6	0.74	32.7	744	0.070	0.017	F4IPA6_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=VAC1 PE=1 SV=1
15	Q9BEC7	0.83	32.3	319	0.259	0.150	NPL_PIG N-acetylneuraminate lyase OS=Sus scrofa OX=9823 GN=NPL PE=1 SV=1
16	Q9WUG6	1.2	31.2	135	0.200	0.274	INSL5_MOUSE Insulin-like peptide INSL5 OS=Mus musculus OX=10090 GN=Insl5 PE=2 SV=1
17	D5IGG0	1.4	31.6	378	0.103	0.050	CARAA_SPHSX Carbazole 1,9a-dioxygenase, terminal oxygenase component CarAa OS=Sphingomonas sp. OX=28214 GN=carAa PE=1 SV=1
18	O09107	2.0	30.4	122	0.065	0.098	INSL3_MOUSE Insulin-like 3 OS=Mus musculus OX=10090 GN=Insl3 PE=1 SV=2
19	P51460	3.1	29.6	131	0.059	0.084	INSL3_HUMAN Insulin-like 3 OS=Homo sapiens OX=9606 GN=INSL3 PE=1 SV=2
20	Q09683	5.3	30.0	649	0.173	0.049	RAD32_SCHPO DNA repair protein rad32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad32 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00049 Insulin	2.8e-16	71.6	Insulin/IGF/Relaxin family
2	PF03488 Ins_beta	14	17.1	Nematode insulin-related peptide beta type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371040

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405841	0.996	Relaxin receptor 1
2	9606.ENSP00000298386	0.972	Relaxin receptor 2
3	9606.ENSP00000397415	0.970	Relaxin-3
4	9606.ENSP00000302724	0.938	Insulin-like peptide INSL5
5	9606.ENSP00000369017	0.934	Insulin-like 3
6	9606.ENSP00000328708	0.907	Relaxin-3 receptor 1
7	9606.ENSP00000357301	0.881	Relaxin-3 receptor 2
8	9606.ENSP00000223862	0.846	Prorelaxin H1
9	9606.ENSP00000239316	0.710	Early placenta insulin-like peptide
10	9606.ENSP00000436607	0.545	ADM
11	9606.ENSP00000270631	0.542	Tuberoinfundibular peptide of 39 residues
12	9606.ENSP00000462647	0.542	Pituitary adenylate cyclase-activating polypeptide
13	9606.ENSP00000381105	0.525	Neuropeptide S
14	9606.ENSP00000387662	0.521	Glucagon
15	9606.ENSP00000276571	0.520	Corticoliberin
16	9606.ENSP00000433490	0.519	Calcitonin gene-related peptide 2
17	9606.ENSP00000379087	0.517	ADM2
18	9606.ENSP00000176195	0.513	Secretin
19	9606.ENSP00000240652	0.512	Islet amyloid polypeptide
20	9606.ENSP00000356213	0.512	VIP peptides

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0048518	0.988	positive regulation of biological process
GO:0032501	0.980	multicellular organismal process
GO:0019222	0.965	regulation of metabolic process
GO:0022414	0.955	reproductive process
GO:0044706	0.945	multi-multicellular organism process
GO:0051240	0.927	positive regulation of multicellular organismal process
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0050794	0.919	regulation of cellular process
GO:1904018	0.907	positive regulation of vasculature development
GO:0009893	0.904	positive regulation of metabolic process
GO:0044703	0.896	multi-organism reproductive process
GO:0010604	0.885	positive regulation of macromolecule metabolic process
GO:0010468	0.884	regulation of gene expression
GO:0009987	0.878	cellular process
GO:0048522	0.810	positive regulation of cellular process
GO:0050896	0.787	response to stimulus
GO:0065009	0.744	regulation of molecular function
GO:0051716	0.732	cellular response to stimulus
GO:0045765	0.732	regulation of angiogenesis
GO:0023052	0.706	signaling
GO:0007154	0.706	cell communication
GO:0007165	0.697	signal transduction
GO:0045766	0.669	positive regulation of angiogenesis
GO:0050790	0.661	regulation of catalytic activity
GO:0007565	0.562	female pregnancy
GO:0032502	0.537	developmental process
GO:0007186	0.459	G protein-coupled receptor signaling pathway
GO:0048519	0.421	negative regulation of biological process
GO:0048856	0.398	anatomical structure development
GO:0048583	0.393	regulation of response to stimulus
GO:0023051	0.380	regulation of signaling
GO:0010646	0.380	regulation of cell communication
GO:0007188	0.366	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0010628	0.313	positive regulation of gene expression
GO:0007275	0.311	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]