StarFunc result for job id P04114

User Input

>input (1400 residues)
MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES
SSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSE
EFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD
TVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS
SSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSD
EAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPE
PSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTG
DEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKD
QEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
FDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALY
WVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRIL
GEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPT
GAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENR
QSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATY
ELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVN
DESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAH
WSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKE
FNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPA
LHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTST
DHFSLRARYHMKADSVVDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MUN2	0.495	0.806	2.517E-99	828	0.572	0.967	A8MUN2.pdb.gz	A8MUN2_HUMAN Apolipoprotein B OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2
2	AFDB:Q6RG02	0.565	0.331	5.366E-47	2586	0.168	0.091	Q6RG02.pdb.gz	VIT_PENME Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2
3	AFDB:Q92093	0.493	0.429	6.466E-43	1659	0.167	0.141	Q92093.pdb.gz	VIT_ONCMY Vitellogenin OS=Oncorhynchus mykiss OX=8022 GN=vtg1 PE=1 SV=1
4	AFDB:Q1MTC4	0.475	0.418	4.817E-42	1631	0.169	0.145	Q1MTC4.pdb.gz	Q1MTC4_DANRE Vitellogenin 2 OS=Danio rerio OX=7955 GN=si:dkey-4c23.2 PE=1 SV=1
5	AFDB:Q1LWN2	0.476	0.487	6.522E-42	1362	0.149	0.153	Q1LWN2.pdb.gz	Q1LWN2_DANRE Vitellogenin 1 OS=Danio rerio OX=7955 GN=vg1 PE=1 SV=1
6	AFDB:F1QQQ3	0.468	0.510	2.111E-41	1253	0.140	0.156	F1QQQ3.pdb.gz	F1QQQ3_DANRE Vitellogenin 3, phosvitinless OS=Danio rerio OX=7955 GN=cb1001 PE=1 SV=3
7	AFDB:P05690	0.434	0.387	1.275E-38	1613	0.152	0.132	P05690.pdb.gz	VIT2_CAEEL Vitellogenin-2 OS=Caenorhabditis elegans OX=6239 GN=vit-2 PE=1 SV=5
8	AFDB:P18948	0.437	0.381	1.862E-38	1651	0.137	0.116	P18948.pdb.gz	VIT6_CAEEL Vitellogenin-6 OS=Caenorhabditis elegans OX=6239 GN=vit-6 PE=1 SV=5
9	AFDB:Q9VF24	0.450	0.431	8.553E-37	1470	0.121	0.116	Q9VF24.pdb.gz	Q9VF24_DROME Crossveinless d OS=Drosophila melanogaster OX=7227 GN=cv-d PE=1 SV=2
10	AFDB:Q7Z1M0	0.386	0.343	2.634E-33	1641	0.134	0.114	Q7Z1M0.pdb.gz	VIT1_SOLIN Vitellogenin-1 OS=Solenopsis invicta OX=13686 PE=2 SV=1
11	PDB:6i7sG	0.340	0.501	1.012E-25	863	0.093	0.151	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
12	PDB:7u05B	0.085	0.128	3.413E-3	815	0.068	0.117	7u05B.pdb.gz
13	PDB:5a1uE	0.109	0.162	6.257E-3	824	0.071	0.121	5a1uE.pdb.gz
14	PDB:5cslB	0.057	0.047	7.562E-3	2072	0.067	0.045	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
15	PDB:2fuqA	0.074	0.113	9.140E-3	747	0.069	0.130	2fuqA.pdb.gz	Crystal Structure of Heparinase II from Pedobacter heparinus and Its Complex with a Disaccharide Product.
16	PDB:6u62A	0.104	0.125	1.878E-2	1110	0.066	0.083	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
17	PDB:7kzpQ	0.029	0.044	2.742E-2	754	0.049	0.090	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
18	PDB:5mqfT	0.087	0.248	6.077E-2	395	0.035	0.124	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
19	PDB:6bcuW	0.107	0.135	6.312E-2	1052	0.064	0.085	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
20	PDB:6g2iA	0.056	0.044	6.556E-2	2080	0.062	0.042	6g2iA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MUN2	0.0	1647	828	0.572	0.967	A8MUN2_HUMAN Apolipoprotein B OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2
2	E9Q414	0.0	2273	4505	0.779	0.242	APOB_MOUSE Apolipoprotein B-100 OS=Mus musculus OX=10090 GN=Apob PE=1 SV=1
3	P04114	0.0	2910	4563	1.000	0.307	APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2
4	Q5TZ29	0.0	863	3730	0.341	0.128	Q5TZ29_DANRE Apolipoprotein Bb, tandem duplicate 1 OS=Danio rerio OX=7955 GN=apobb PE=1 SV=1
5	Q7TMA5	0.0	2212	4743	0.756	0.223	APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus OX=10116 GN=Apob PE=1 SV=1
6	Q6RG02	4.67e-25	116	2586	0.141	0.077	VIT_PENME Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2
7	Q7KTG2	2.87e-21	104	4333	0.116	0.037	Q7KTG2_DROME Apolipoprotein lipid transfer particle OS=Drosophila melanogaster OX=7227 GN=Apoltp PE=1 SV=2
8	Q9V496	8.42e-21	102	3351	0.144	0.060	APLP_DROME Apolipophorins OS=Drosophila melanogaster OX=7227 GN=apolpp PE=1 SV=2
9	Q1MTC4	1.83e-19	97.8	1631	0.156	0.134	Q1MTC4_DANRE Vitellogenin 2 OS=Danio rerio OX=7955 GN=si:dkey-4c23.2 PE=1 SV=1
10	Q1LWN2	1.67e-13	78.2	1362	0.121	0.125	Q1LWN2_DANRE Vitellogenin 1 OS=Danio rerio OX=7955 GN=vg1 PE=1 SV=1
11	F1QQQ3	2.87e-09	64.3	1253	0.136	0.152	F1QQQ3_DANRE Vitellogenin 3, phosvitinless OS=Danio rerio OX=7955 GN=cb1001 PE=1 SV=3
12	Q92093	5.57e-08	60.5	1659	0.079	0.067	VIT_ONCMY Vitellogenin OS=Oncorhynchus mykiss OX=8022 GN=vtg1 PE=1 SV=1
13	P18948	0.004	44.7	1651	0.069	0.058	VIT6_CAEEL Vitellogenin-6 OS=Caenorhabditis elegans OX=6239 GN=vit-6 PE=1 SV=5
14	Q9W6Z4	0.064	39.7	309	0.026	0.120	Q9W6Z4_ONCMY Vitellogenin (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=vgt PE=4 SV=1
15	O93605	0.069	39.7	309	0.026	0.120	O93605_ONCMY Vitellogenin (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=vgt PE=4 SV=1
16	P05690	0.16	38.9	1613	0.076	0.066	VIT2_CAEEL Vitellogenin-2 OS=Caenorhabditis elegans OX=6239 GN=vit-2 PE=1 SV=5
17	Q9PSX4	0.17	38.1	309	0.026	0.120	Q9PSX4_ONCMY Vitellogenin (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=vgt PE=4 SV=1
18	Q9U572	0.57	37.4	1670	0.031	0.026	CLOT_PENMO Hemolymph clottable protein OS=Penaeus monodon OX=6687 PE=1 SV=1
19	A0A2R8QQC0	0.77	35.8	252	0.023	0.127	A0A2R8QQC0_DANRE Mast cell protease 2 isoform X1 OS=Danio rerio OX=7955 GN=si:ch211-212d10.1 PE=1 SV=1
20	Q5U870	1.8	35.4	511	0.020	0.055	Q5U870_DANRE Brain aromatase OS=Danio rerio OX=7955 GN=cyp19b PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06448 DUF1081	4.6e-38	141.5	Domain of Unknown Function (DUF1081)
2	PF02955 GSH-S_ATP	4.7e+02	11.6	Prokaryotic glutathione synthetase, ATP-grasp domain
3	PF12068 PH_RBD	1.1e+02	13.7	Rab-binding domain (RBD)
4	PF01347 Vitellogenin_N	2e-101	352.0	Lipoprotein amino terminal region
5	PF09172 Vit_open_b-sht	1.2e-76	269.4	Vitellinogen, open beta-sheet

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233242

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321334	0.999	Apolipoprotein(a)
2	9606.ENSP00000427679	0.999	Microsomal triglyceride transfer protein large subunit
3	9606.ENSP00000454071	0.999	Low-density lipoprotein receptor
4	9606.ENSP00000236850	0.998	Apolipoprotein A-I
5	9606.ENSP00000252486	0.998	Apolipoprotein E
6	9606.ENSP00000227667	0.996	Apolipoprotein C-III
7	9606.ENSP00000356969	0.996	Apolipoprotein A-II
8	9606.ENSP00000309757	0.992	Lipoprotein lipase
9	9606.ENSP00000256637	0.991	Sortilin
10	9606.ENSP00000200676	0.989	Cholesteryl ester transfer protein
11	9606.ENSP00000445002	0.989	Apolipoprotein A-V
12	9606.ENSP00000327801	0.983	Protein disulfide-isomerase
13	9606.ENSP00000299022	0.981	Hepatic triacylglycerol lipase
14	9606.ENSP00000350425	0.981	Apolipoprotein A-IV
15	9606.ENSP00000466775	0.980	Apolipoprotein C-II
16	9606.ENSP00000205948	0.977	Beta-2-glycoprotein 1
17	9606.ENSP00000337731	0.973	Cell death activator CIDE-B
18	9606.ENSP00000274793	0.967	Platelet-activating factor acetylhydrolase
19	9606.ENSP00000263816	0.966	Low-density lipoprotein receptor-related protein 2
20	9606.ENSP00000243077	0.959	Prolow-density lipoprotein receptor-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	0.998	lipid binding
GO:0005102	0.997	signaling receptor binding
GO:0097367	0.996	carbohydrate derivative binding
GO:0070325	0.993	lipoprotein particle receptor binding
GO:0120013	0.990	lipid transfer activity
GO:1901681	0.894	sulfur compound binding
GO:0120015	0.870	sterol transfer activity
GO:0005539	0.822	glycosaminoglycan binding
GO:0120020	0.819	cholesterol transfer activity
GO:0050750	0.801	low-density lipoprotein particle receptor binding
GO:0005543	0.757	phospholipid binding
GO:0008201	0.735	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006629	0.973	lipid metabolic process
GO:0009987	0.928	cellular process
GO:0055092	0.884	sterol homeostasis
GO:0015850	0.883	organic hydroxy compound transport
GO:0050789	0.874	regulation of biological process
GO:0006869	0.870	lipid transport
GO:0015918	0.859	sterol transport
GO:0042632	0.828	cholesterol homeostasis
GO:0044237	0.821	cellular metabolic process
GO:0006638	0.747	neutral lipid metabolic process
GO:0071825	0.681	protein-lipid complex subunit organization
GO:0032501	0.670	multicellular organismal process
GO:0009056	0.497	catabolic process
GO:0046486	0.466	glycerolipid metabolic process
GO:0050896	0.441	response to stimulus
GO:0030301	0.428	cholesterol transport
GO:0097006	0.324	regulation of plasma lipoprotein particle levels
GO:0071827	0.317	plasma lipoprotein particle organization
GO:0048518	0.310	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0005576	0.997	extracellular region
GO:0012505	0.970	endomembrane system
GO:0005829	0.930	cytosol
GO:0032991	0.916	protein-containing complex
GO:0031974	0.901	membrane-enclosed lumen
GO:0016020	0.891	membrane
GO:0043233	0.890	organelle lumen
GO:0005783	0.727	endoplasmic reticulum
GO:0031090	0.668	organelle membrane
GO:0005615	0.644	extracellular space
GO:0031982	0.623	vesicle
GO:0097708	0.334	intracellular vesicle
GO:0012506	0.326	vesicle membrane
GO:0031410	0.324	cytoplasmic vesicle
GO:0070013	0.309	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.870	cholesterol(in) = cholesterol(out)

[back to server]