StarFunc result for job id P04141

User Input

>input (144 residues)
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04141	1.000	1.000	1.428E-24	144	1.000	1.000	P04141.pdb.gz	CSF2_HUMAN Granulocyte-macrophage colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF2 PE=1 SV=1
2	AFDB:I3L8Q3	0.873	0.873	1.446E-19	144	0.715	0.715	I3L8Q3.pdb.gz	I3L8Q3_PIG Granulocyte-macrophage colony-stimulating factor OS=Sus scrofa OX=9823 GN=CSF2 PE=3 SV=1
3	PDB:2gmfA	0.776	0.922	1.919E-18	121	0.840	1.000	2gmfA.pdb.gz
4	AFDB:P48750	0.788	0.788	1.984E-16	144	0.632	0.632	P48750.pdb.gz	CSF2_RAT Granulocyte-macrophage colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf2 PE=2 SV=2
5	AFDB:P01587	0.782	0.798	3.168E-14	141	0.542	0.553	P01587.pdb.gz	CSF2_MOUSE Granulocyte-macrophage colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf2 PE=1 SV=1
6	AFDB:O42288	0.380	0.382	5.481E-2	143	0.146	0.147	O42288.pdb.gz	O42288_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL2 PE=2 SV=1
7	AFDB:P17108	0.416	0.394	6.834E-2	155	0.132	0.123	P17108.pdb.gz	IL2_RAT Interleukin-2 OS=Rattus norvegicus OX=10116 GN=Il2 PE=2 SV=1
8	AFDB:P42203	0.431	0.467	2.059E-1	131	0.132	0.145	P42203.pdb.gz	IL13_RAT Interleukin-13 OS=Rattus norvegicus OX=10116 GN=Il13 PE=2 SV=1
9	PDB:4nemA	0.430	0.512	2.163E-1	114	0.076	0.096	4nemA.pdb.gz	Small molecular fragments bound to binding energy hot-spot in crystal contact interface of Interleukin-2
10	PDB:7ra9A	0.432	0.473	2.163E-1	126	0.090	0.103	7ra9A.pdb.gz
11	AFDB:P49771	0.361	0.258	2.176E-1	235	0.139	0.085	P49771.pdb.gz	FLT3L_HUMAN Fms-related tyrosine kinase 3 ligand OS=Homo sapiens OX=9606 GN=FLT3LG PE=1 SV=1
12	AFDB:P49772	0.355	0.254	2.866E-1	232	0.167	0.103	P49772.pdb.gz	FLT3L_MOUSE Fms-related tyrosine kinase 3 ligand OS=Mus musculus OX=10090 GN=Flt3lg PE=2 SV=1
13	AFDB:B7TXY8	0.325	0.245	3.201E-1	208	0.181	0.125	B7TXY8.pdb.gz	B7TXY8_SHEEP Interleukin-6 OS=Ovis aries OX=9940 PE=3 SV=1
14	PDB:1itlA	0.308	0.330	4.680E-1	130	0.153	0.169	1itlA.pdb.gz
15	PDB:3qb1G	0.401	0.490	4.945E-1	111	0.076	0.099	3qb1G.pdb.gz
16	PDB:1ga3A	0.334	0.394	1.131	113	0.153	0.195	1ga3A.pdb.gz
17	PDB:1ax8A	0.379	0.412	1.490	130	0.083	0.092	1ax8A.pdb.gz
18	PDB:2l3yA	0.244	0.197	1.490	184	0.174	0.136	2l3yA.pdb.gz
19	PDB:1jmoA	0.157	0.070	1.574	427	0.104	0.035	1jmoA.pdb.gz
20	PDB:2kmfA	0.223	0.270	2.316	115	0.118	0.148	2kmfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04141	2.84e-105	298	144	1.000	1.000	CSF2_HUMAN Granulocyte-macrophage colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF2 PE=1 SV=1
2	Q29118	4.20e-75	222	144	0.722	0.722	CSF2_PIG Granulocyte-macrophage colony-stimulating factor OS=Sus scrofa OX=9823 GN=CSF2 PE=2 SV=1
3	I3L8Q3	7.19e-75	221	144	0.715	0.715	I3L8Q3_PIG Granulocyte-macrophage colony-stimulating factor OS=Sus scrofa OX=9823 GN=CSF2 PE=3 SV=1
4	P48750	5.49e-66	199	144	0.632	0.632	CSF2_RAT Granulocyte-macrophage colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf2 PE=2 SV=2
5	P01587	3.49e-53	166	141	0.549	0.560	CSF2_MOUSE Granulocyte-macrophage colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf2 PE=1 SV=1
6	Q2W8R0	0.87	31.6	431	0.083	0.028	MAMH_MAGSA Magnetosome protein MamH OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=mamH PE=3 SV=1
7	Q5SNX7	2.1	30.4	660	0.146	0.032	GALC_DANRE Galactocerebrosidase OS=Danio rerio OX=7955 GN=galc PE=2 SV=1
8	O59786	2.8	30.0	423	0.111	0.038	HEMH_SCHPO Ferrochelatase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hem15 PE=3 SV=2
9	O14763	5.3	29.3	440	0.062	0.020	TR10B_HUMAN Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01109 GM_CSF	1.8e-66	233.3	Granulocyte-macrophage colony-stimulating factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384053	0.999	Cytokine receptor common subunit beta
2	9606.ENSP00000394227	0.999	Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
3	9606.ENSP00000296870	0.994	Interleukin-3
4	9606.ENSP00000225474	0.992	Granulocyte colony-stimulating factor
5	9606.ENSP00000385675	0.991	Interleukin-6
6	9606.ENSP00000398698	0.990	Tumor necrosis factor
7	9606.ENSP00000225831	0.988	C-C motif chemokine 2
8	9606.ENSP00000263341	0.988	Interleukin-1 beta
9	9606.ENSP00000306512	0.988	Interleukin-8
10	9606.ENSP00000412237	0.988	Interleukin-10
11	9606.ENSP00000477908	0.988	C-C motif chemokine 3
12	9606.ENSP00000263339	0.987	Interleukin-1 alpha
13	9606.ENSP00000474412	0.986	C-C motif chemokine 5
14	9606.ENSP00000482259	0.986	C-C motif chemokine 4
15	9606.ENSP00000228280	0.983	Kit ligand
16	9606.ENSP00000305651	0.982	C-X-C motif chemokine 10
17	9606.ENSP00000379110	0.981	Growth-regulated alpha protein
18	9606.ENSP00000280357	0.973	Interleukin-18
19	9606.ENSP00000293328	0.973	Signal transducer and activator of transcription 5B
20	9606.ENSP00000351671	0.972	C-C motif chemokine 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005126	1.000	cytokine receptor binding
GO:0005125	1.000	cytokine activity
GO:0070851	0.989	growth factor receptor binding
GO:0005129	0.797	granulocyte macrophage colony-stimulating factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0051716	0.973	cellular response to stimulus
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0050793	0.960	regulation of developmental process
GO:0007165	0.957	signal transduction
GO:0042221	0.953	response to chemical
GO:0008284	0.951	positive regulation of cell population proliferation
GO:0032501	0.924	multicellular organismal process
GO:0071704	0.914	organic substance metabolic process
GO:0002376	0.913	immune system process
GO:0048856	0.912	anatomical structure development
GO:0070887	0.864	cellular response to chemical stimulus
GO:0051239	0.861	regulation of multicellular organismal process
GO:0010033	0.847	response to organic substance
GO:0009893	0.846	positive regulation of metabolic process
GO:0071310	0.841	cellular response to organic substance
GO:0030154	0.840	cell differentiation
GO:0010468	0.830	regulation of gene expression
GO:0030097	0.830	hemopoiesis
GO:0043170	0.800	macromolecule metabolic process
GO:0051240	0.780	positive regulation of multicellular organismal process
GO:0044237	0.779	cellular metabolic process
GO:0048583	0.771	regulation of response to stimulus
GO:0035556	0.764	intracellular signal transduction
GO:0080090	0.762	regulation of primary metabolic process
GO:0051171	0.756	regulation of nitrogen compound metabolic process
GO:0006807	0.744	nitrogen compound metabolic process
GO:0010604	0.710	positive regulation of macromolecule metabolic process
GO:0048519	0.704	negative regulation of biological process
GO:0002521	0.687	leukocyte differentiation
GO:0031323	0.668	regulation of cellular metabolic process
GO:0034097	0.660	response to cytokine
GO:0007166	0.649	cell surface receptor signaling pathway
GO:1901564	0.645	organonitrogen compound metabolic process
GO:0044238	0.627	primary metabolic process
GO:0031399	0.625	regulation of protein modification process
GO:0048523	0.619	negative regulation of cellular process
GO:0042325	0.616	regulation of phosphorylation
GO:0031325	0.608	positive regulation of cellular metabolic process
GO:0051247	0.607	positive regulation of protein metabolic process
GO:0001932	0.571	regulation of protein phosphorylation
GO:0023051	0.568	regulation of signaling
GO:0006793	0.561	phosphorus metabolic process
GO:0006950	0.549	response to stress
GO:0071345	0.546	cellular response to cytokine stimulus
GO:0019221	0.499	cytokine-mediated signaling pathway
GO:0009966	0.498	regulation of signal transduction
GO:0001775	0.494	cell activation
GO:0001934	0.492	positive regulation of protein phosphorylation
GO:0048584	0.478	positive regulation of response to stimulus
GO:0002682	0.473	regulation of immune system process
GO:1903131	0.461	mononuclear cell differentiation
GO:0001817	0.451	regulation of cytokine production
GO:0010628	0.437	positive regulation of gene expression
GO:0006955	0.402	immune response
GO:0042981	0.386	regulation of apoptotic process
GO:0002684	0.369	positive regulation of immune system process
GO:0006952	0.354	defense response
GO:0009889	0.351	regulation of biosynthetic process
GO:0009605	0.340	response to external stimulus
GO:0001819	0.334	positive regulation of cytokine production
GO:0045595	0.332	regulation of cell differentiation
GO:0031326	0.329	regulation of cellular biosynthetic process
GO:0019219	0.329	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.327	regulation of macromolecule biosynthetic process
GO:0051252	0.321	regulation of RNA metabolic process
GO:0051094	0.319	positive regulation of developmental process
GO:0045321	0.313	leukocyte activation
GO:0050730	0.308	regulation of peptidyl-tyrosine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005886	0.967	plasma membrane
GO:0005622	0.841	intracellular anatomical structure
GO:0043226	0.674	organelle
GO:0005737	0.657	cytoplasm
GO:0043227	0.648	membrane-bounded organelle
GO:0043231	0.635	intracellular membrane-bounded organelle
GO:0032991	0.456	protein-containing complex
GO:0098796	0.443	membrane protein complex
GO:0098797	0.433	plasma membrane protein complex
GO:0098802	0.421	plasma membrane signaling receptor complex
GO:0030526	0.345	granulocyte macrophage colony-stimulating factor receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]