StarFunc result for job id P04150

User Input

>input (777 residues)
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KQF6	0.445	0.445	9.851E-87	778	0.999	0.997	E5KQF6.pdb.gz	E5KQF6_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=3 SV=1
2	AFDB:A0A494C0P1	0.303	0.316	2.850E-82	746	0.960	1.000	A0A494C0P1.pdb.gz	A0A494C0P1_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1
3	AFDB:A0A1D5PRD7	0.453	0.456	7.351E-73	772	0.750	0.755	A0A1D5PRD7.pdb.gz	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
4	AFDB:P07812	0.419	0.414	1.064E-37	786	0.346	0.342	P07812.pdb.gz	PRGR_CHICK Progesterone receptor OS=Gallus gallus OX=9031 GN=PGR PE=1 SV=1
5	AFDB:C1KB84	0.331	0.270	2.720E-37	986	0.393	0.309	C1KB84.pdb.gz	C1KB84_CHICK Mineralocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C2 PE=2 SV=1
6	AFDB:A6YIH7	0.448	0.361	3.131E-37	970	0.382	0.306	A6YIH7.pdb.gz	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
7	AFDB:Q00175	0.395	0.335	4.775E-37	926	0.368	0.309	Q00175.pdb.gz	PRGR_MOUSE Progesterone receptor OS=Mus musculus OX=10090 GN=Pgr PE=1 SV=2
8	AFDB:P06401	0.388	0.327	9.209E-37	933	0.376	0.313	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
9	AFDB:B0ZBF6	0.362	0.292	2.142E-36	984	0.390	0.308	B0ZBF6.pdb.gz	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
10	AFDB:Q9I8F5	0.317	0.294	3.118E-36	839	0.333	0.309	Q9I8F5.pdb.gz	Q9I8F5_PIMPR Androgen receptor OS=Pimephales promelas OX=90988 PE=2 SV=2
11	PDB:7kw7F	0.281	0.818	1.621E-30	259	0.331	0.992	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
12	PDB:3dzyA	0.232	0.578	4.238E-13	302	0.112	0.288	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
13	PDB:1g2nA	0.242	0.717	8.829E-9	246	0.077	0.244	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:6fx0A	0.246	0.736	4.759E-7	238	0.053	0.172	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
15	PDB:7dvqV	0.075	0.109	3.503E-1	468	0.042	0.071	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:6lthL	0.076	0.108	7.419E-1	466	0.041	0.069	6lthL.pdb.gz	Structure of nucleosome-bound human BAF complex.
17	PDB:1jqiA	0.060	0.095	7.775E-1	384	0.032	0.065	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
18	PDB:7r5jA0	0.072	0.070	1.080	818	0.041	0.039	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:6gn0A	0.074	0.158	1.243	239	0.027	0.088	6gn0A.pdb.gz
20	PDB:6d7lA	0.085	0.160	1.365	288	0.040	0.108	6d7lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PRD7	0.0	1183	772	0.749	0.754	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
2	A0A494C0P1	0.0	1535	746	0.960	1.000	A0A494C0P1_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1
3	E5KQF5	0.0	1509	742	0.937	0.981	E5KQF5_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=3 SV=1
4	E5KQF6	0.0	1607	778	1.000	0.999	E5KQF6_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=3 SV=1
5	F1D8N4	0.0	1612	777	1.000	1.000	F1D8N4_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=2 SV=1
6	P04150	0.0	1612	777	1.000	1.000	GCR_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1
7	P06536	0.0	1403	795	0.903	0.883	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
8	P06537	0.0	1397	792	0.902	0.885	GCR_MOUSE Glucocorticoid receptor OS=Mus musculus OX=10090 GN=Nr3c1 PE=1 SV=2
9	P49843	0.0	662	758	0.479	0.491	GCR_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=1 SV=1
10	Q1XHK0	0.0	690	746	0.494	0.515	Q1XHK0_DANRE Glucocorticoid receptor OS=Danio rerio OX=7955 GN=fb13f09 PE=2 SV=1
11	Q38HX7	0.0	1181	772	0.749	0.754	Q38HX7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=GR PE=2 SV=1
12	Q6RKQ3	0.0	647	669	0.462	0.537	Q6RKQ3_ONCMY Glucocorticoid receptor OS=Oncorhynchus mykiss OX=8022 GN=nr3c1 PE=2 SV=1
13	A6YIH7	8.22e-164	501	970	0.340	0.272	A6YIH7_DANRE Mineralocorticoid receptor OS=Danio rerio OX=7955 GN=mr PE=2 SV=1
14	B0ZBF6	5.37e-153	473	984	0.329	0.260	B0ZBF6_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=4 SV=1
15	P08235	5.37e-153	473	984	0.329	0.260	MCR_HUMAN Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=1 SV=2
16	C1KB84	9.85e-152	470	986	0.337	0.266	C1KB84_CHICK Mineralocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C2 PE=2 SV=1
17	P22199	1.16e-151	469	981	0.331	0.262	MCR_RAT Mineralocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c2 PE=1 SV=1
18	Q8VII8	2.32e-148	461	978	0.328	0.261	MCR_MOUSE Mineralocorticoid receptor OS=Mus musculus OX=10090 GN=Nr3c2 PE=1 SV=2
19	Q690N0	2.32e-147	442	482	0.275	0.444	Q690N0_BOVIN Progesterone receptor (Fragment) OS=Bos taurus OX=9913 GN=PGR PE=2 SV=1
20	P07812	4.66e-144	444	786	0.277	0.274	PRGR_CHICK Progesterone receptor OS=Gallus gallus OX=9031 GN=PGR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02155 GCR	4.7e-199	672.8	Glucocorticoid receptor
2	PF00104 Hormone_recep	2.1e-27	107.6	Ligand-binding domain of nuclear hormone receptor
3	PF00105 zf-C4	1e-24	98.1	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000231509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000001008	0.999	Peptidyl-prolyl cis-trans isomerase FKBP4
2	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
3	9606.ENSP00000385216	0.999	Nuclear receptor coactivator 1
4	9606.ENSP00000399968	0.999	Nuclear receptor coactivator 2
5	9606.ENSP00000444810	0.999	Peptidyl-prolyl cis-trans isomerase FKBP5
6	9606.ENSP00000360266	0.998	Transcription factor AP-1
7	9606.ENSP00000395654	0.998	Transcription activator BRG1
8	9606.ENSP00000263253	0.997	Histone acetyltransferase p300
9	9606.ENSP00000262367	0.993	CREB-binding protein
10	9606.ENSP00000302961	0.993	Heat shock protein family A member 4
11	9606.ENSP00000264657	0.992	Signal transducer and activator of transcription 3
12	9606.ENSP00000384273	0.992	Transcription factor p65
13	9606.ENSP00000341208	0.990	Signal transducer and activator of transcription 5A
14	9606.ENSP00000268712	0.985	Nuclear receptor corepressor 1
15	9606.ENSP00000427514	0.985	CCAAT/enhancer-binding protein alpha
16	9606.ENSP00000361066	0.984	Nuclear receptor coactivator 3
17	9606.ENSP00000430432	0.981	Histone deacetylase 2
18	9606.ENSP00000254480	0.980	SWI/SNF complex subunit SMARCC1
19	9606.ENSP00000269305	0.979	Cellular tumor antigen p53
20	9606.ENSP00000293328	0.979	Signal transducer and activator of transcription 5B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003707	1.000	nuclear steroid receptor activity
GO:0005496	0.999	steroid binding
GO:0005515	0.997	protein binding
GO:0140110	0.995	transcription regulator activity
GO:0003677	0.995	DNA binding
GO:0003700	0.994	DNA-binding transcription factor activity
GO:0042562	0.993	hormone binding
GO:0043565	0.988	sequence-specific DNA binding
GO:1990239	0.972	steroid hormone binding
GO:1990837	0.965	sequence-specific double-stranded DNA binding
GO:0000981	0.954	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0019899	0.934	enzyme binding
GO:0000976	0.932	transcription cis-regulatory region binding
GO:0098531	0.917	ligand-activated transcription factor activity
GO:0000977	0.830	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0004879	0.479	nuclear receptor activity
GO:0001228	0.424	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0031072	0.349	heat shock protein binding
GO:0051879	0.341	Hsp90 protein binding
GO:0004883	0.341	nuclear glucocorticoid receptor activity
GO:0000987	0.325	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.305	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0010604	0.992	positive regulation of macromolecule metabolic process
GO:0033993	0.988	response to lipid
GO:0070887	0.988	cellular response to chemical stimulus
GO:0014070	0.985	response to organic cyclic compound
GO:0009725	0.985	response to hormone
GO:0071310	0.984	cellular response to organic substance
GO:0071495	0.977	cellular response to endogenous stimulus
GO:0048545	0.972	response to steroid hormone
GO:1902680	0.968	positive regulation of RNA biosynthetic process
GO:1901700	0.967	response to oxygen-containing compound
GO:0006355	0.967	regulation of DNA-templated transcription
GO:0071384	0.955	cellular response to corticosteroid stimulus
GO:0071385	0.936	cellular response to glucocorticoid stimulus
GO:0023052	0.901	signaling
GO:1903508	0.896	positive regulation of nucleic acid-templated transcription
GO:1901654	0.895	response to ketone
GO:0007154	0.879	cell communication
GO:1901701	0.871	cellular response to oxygen-containing compound
GO:0045893	0.861	positive regulation of DNA-templated transcription
GO:1901655	0.750	cellular response to ketone
GO:0048519	0.746	negative regulation of biological process
GO:0032501	0.667	multicellular organismal process
GO:0007165	0.638	signal transduction
GO:0048523	0.607	negative regulation of cellular process
GO:0032502	0.562	developmental process
GO:0048856	0.539	anatomical structure development
GO:0009892	0.466	negative regulation of metabolic process
GO:0006357	0.461	regulation of transcription by RNA polymerase II
GO:0010605	0.457	negative regulation of macromolecule metabolic process
GO:0051172	0.447	negative regulation of nitrogen compound metabolic process
GO:0031324	0.423	negative regulation of cellular metabolic process
GO:0023051	0.394	regulation of signaling
GO:0048583	0.393	regulation of response to stimulus
GO:0010646	0.393	regulation of cell communication
GO:0008152	0.391	metabolic process
GO:0071704	0.340	organic substance metabolic process
GO:0006950	0.339	response to stress
GO:0007275	0.334	multicellular organism development
GO:0045944	0.327	positive regulation of transcription by RNA polymerase II
GO:0051239	0.316	regulation of multicellular organismal process
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]