StarFunc result for job id P04156

User Input

>input (253 residues)
MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP
HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV
NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
ILLISFLIFLIVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04273	0.566	0.564	2.998E-36	254	0.897	0.894	P04273.pdb.gz	PRIO_MESAU Major prion protein OS=Mesocricetus auratus OX=10036 GN=PRNP PE=1 SV=1
2	AFDB:P10279	0.744	0.716	2.759E-35	264	0.917	0.879	P10279.pdb.gz	PRIO_BOVIN Major prion protein OS=Bos taurus OX=9913 GN=PRNP PE=1 SV=2
3	PDB:4kmlA	0.415	0.941	1.376E-17	109	0.431	1.000	4kmlA.pdb.gz
4	AFDB:D6PZR1	0.307	0.289	2.364E-11	273	0.391	0.363	D6PZR1.pdb.gz	D6PZR1_CHICK PRNP OS=Gallus gallus OX=9031 PE=3 SV=1
5	AFDB:F6TNN0	0.209	0.070	1.788	922	0.119	0.033	F6TNN0.pdb.gz	F6TNN0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=nf-e2 PE=1 SV=2
6	AFDB:A8KB41	0.149	0.115	1.905	345	0.134	0.099	A8KB41.pdb.gz	A8KB41_DANRE Homeobox protein Nkx-2.4 isoform 1 OS=Danio rerio OX=7955 GN=fi48a12 PE=2 SV=1
7	AFDB:Q9EPL0	0.096	0.031	3.164	865	0.126	0.037	Q9EPL0.pdb.gz	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
8	AFDB:Q386W5	0.185	0.113	3.371	464	0.154	0.084	Q386W5.pdb.gz	Q386W5_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0013 PE=4 SV=1
9	AFDB:Q9BQG1	0.101	0.051	3.371	590	0.146	0.063	Q9BQG1.pdb.gz	SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens OX=9606 GN=SYT3 PE=1 SV=1
10	AFDB:C9JBM0	0.210	0.202	4.077	265	0.115	0.109	C9JBM0.pdb.gz
11	AFDB:Q5U5Z8	0.105	0.039	4.344	902	0.071	0.020	Q5U5Z8.pdb.gz	CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2
12	PDB:4v8mBc	0.124	0.208	6.602	140	0.032	0.057	4v8mBc.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	PDB:1e7dA	0.097	0.137	7.495	157	0.051	0.083	1e7dA.pdb.gz	Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
14	PDB:4ajwA	0.072	0.029	7.495	765	0.008	0.003	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
15	PDB:4ajwB	0.072	0.028	7.495	792	0.008	0.003	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
16	PDB:6c4iv	0.122	0.087	7.985	362	0.032	0.022	6c4iv.pdb.gz	Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
17	PDB:5c0wL	0.139	0.259	8.508	113	0.047	0.106	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
18	PDB:3nzqA	0.127	0.060	9.065	628	0.020	0.008	3nzqA.pdb.gz	Structures of bacterial biosynthetic arginine decarboxylases.
19	PDB:5c0xB	0.162	0.168	9.659	244	0.008	0.008	5c0xB.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A2V1	0.0	513	249	0.984	1.000	A2A2V1_HUMAN Major prion protein (Fragment) OS=Homo sapiens OX=9606 GN=PRNP PE=1 SV=1
2	P04156	0.0	520	253	1.000	1.000	PRIO_HUMAN Major prion protein OS=Homo sapiens OX=9606 GN=PRNP PE=1 SV=1
3	Q53YK7	0.0	520	253	1.000	1.000	Q53YK7_HUMAN Major prion protein OS=Homo sapiens OX=9606 GN=PRNP PE=2 SV=1
4	X6RKS3	3.29e-161	447	217	0.858	1.000	X6RKS3_HUMAN Major prion protein (Fragment) OS=Homo sapiens OX=9606 GN=PRNP PE=1 SV=1
5	P04925	2.57e-135	383	254	0.897	0.894	PRIO_MOUSE Major prion protein OS=Mus musculus OX=10090 GN=Prnp PE=1 SV=2
6	P04273	9.09e-128	364	254	0.897	0.894	PRIO_MESAU Major prion protein OS=Mesocricetus auratus OX=10036 GN=PRNP PE=1 SV=1
7	P13852	1.41e-127	363	254	0.897	0.894	PRIO_RAT Major prion protein OS=Rattus norvegicus OX=10116 GN=Prnp PE=1 SV=2
8	P23907	1.20e-121	348	256	0.897	0.887	PRIO_SHEEP Major prion protein OS=Ovis aries OX=9940 GN=PRNP PE=1 SV=1
9	Q95211	5.12e-118	339	252	0.783	0.786	PRIO_RABIT Major prion protein OS=Oryctolagus cuniculus OX=9986 GN=PRNP PE=1 SV=1
10	P10279	3.92e-117	337	264	0.905	0.867	PRIO_BOVIN Major prion protein OS=Bos taurus OX=9913 GN=PRNP PE=1 SV=2
11	P49927	8.16e-102	298	257	0.834	0.821	PRIO_PIG Major prion protein OS=Sus scrofa OX=9823 GN=PRNP PE=1 SV=1
12	P27177	4.81e-20	88.6	273	0.332	0.308	PRIO_CHICK Major prion protein homolog OS=Gallus gallus OX=9031 GN=PRNP PE=1 SV=2
13	D6PZR1	6.15e-20	88.2	273	0.332	0.308	D6PZR1_CHICK PRNP OS=Gallus gallus OX=9031 PE=3 SV=1
14	O88664	6.10e-05	46.2	1001	0.107	0.027	TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus OX=10116 GN=Taok1 PE=1 SV=1
15	Q5F2E8	7.65e-05	45.8	1001	0.107	0.027	TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus OX=10090 GN=Taok1 PE=1 SV=1
16	Q7L7X3	1.77e-04	45.1	1001	0.103	0.026	TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens OX=9606 GN=TAOK1 PE=1 SV=1
17	Q9QUG3	0.001	40.8	179	0.099	0.140	PRND_MOUSE Prion-like protein doppel OS=Mus musculus OX=10090 GN=Prnd PE=1 SV=1
18	Q387F2	0.047	37.4	1553	0.087	0.014	Q387F2_TRYB2 Nucleoporin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0140 PE=4 SV=1
19	P32019	0.14	35.8	993	0.095	0.024	I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=4
20	A0A0R4IR86	0.15	35.8	1799	0.154	0.022	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12708 Pectate_lyase_3	70	14.7	Pectate lyase superfamily protein
2	PF00377 Prion	3.9e-33	125.3	Prion/Doppel alpha-helical domain
3	PF11587 Prion_bPrPp	1.6e-13	61.4	Major prion protein bPrPp - N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351646	0.998	Stress-induced-phosphoprotein 1
2	9606.ENSP00000346067	0.997	40S ribosomal protein SA
3	9606.ENSP00000346671	0.997	Tyrosine-protein kinase Fyn
4	9606.ENSP00000284981	0.993	Amyloid-beta A4 protein
5	9606.ENSP00000480132	0.991	Neural cell adhesion molecule 1
6	9606.ENSP00000308938	0.987	Plasminogen
7	9606.ENSP00000324173	0.984	78 kDa glucose-regulated protein
8	9606.ENSP00000306138	0.983	Metabotropic glutamate receptor 5
9	9606.ENSP00000339191	0.979	Caveolin-1
10	9606.ENSP00000264039	0.965	Glypican-1
11	9606.ENSP00000433560	0.959	Alpha-crystallin B chain
12	9606.ENSP00000468500	0.948	Glial fibrillary acidic protein
13	9606.ENSP00000256509	0.946	Neural cell adhesion molecule L1-like protein
14	9606.ENSP00000373620	0.922	60 kDa heat shock protein, mitochondrial
15	9606.ENSP00000383392	0.922	Neural cell adhesion molecule 2
16	9606.ENSP00000243077	0.919	Prolow-density lipoprotein receptor-related protein 1
17	9606.ENSP00000306900	0.919	Prion-like protein doppel
18	9606.ENSP00000338345	0.919	Alpha-synuclein
19	9606.ENSP00000324532	0.912	Laminin subunit alpha-3
20	9606.ENSP00000356581	0.912	Adhesion G-protein coupled receptor G6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:0005507	0.938	copper ion binding
GO:0060090	0.800	molecular adaptor activity
GO:0044877	0.469	protein-containing complex binding
GO:0005102	0.458	signaling receptor binding
GO:0097159	0.404	organic cyclic compound binding
GO:1901681	0.389	sulfur compound binding
GO:1901363	0.334	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0032879	0.993	regulation of localization
GO:0050890	0.993	cognition
GO:0042221	0.991	response to chemical
GO:0009987	0.983	cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0065009	0.978	regulation of molecular function
GO:0065008	0.974	regulation of biological quality
GO:0010941	0.973	regulation of cell death
GO:0048522	0.972	positive regulation of cellular process
GO:0048519	0.964	negative regulation of biological process
GO:0051173	0.960	positive regulation of nitrogen compound metabolic process
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0043067	0.951	regulation of programmed cell death
GO:0031323	0.951	regulation of cellular metabolic process
GO:0010033	0.944	response to organic substance
GO:0051247	0.938	positive regulation of protein metabolic process
GO:0051716	0.934	cellular response to stimulus
GO:0051049	0.924	regulation of transport
GO:0001932	0.922	regulation of protein phosphorylation
GO:0010468	0.917	regulation of gene expression
GO:0042981	0.909	regulation of apoptotic process
GO:0007611	0.906	learning or memory
GO:0016043	0.904	cellular component organization
GO:0031325	0.897	positive regulation of cellular metabolic process
GO:0060341	0.894	regulation of cellular localization
GO:1901698	0.886	response to nitrogen compound
GO:0008152	0.873	metabolic process
GO:1904375	0.871	regulation of protein localization to cell periphery
GO:0050790	0.867	regulation of catalytic activity
GO:1905475	0.864	regulation of protein localization to membrane
GO:0050731	0.862	positive regulation of peptidyl-tyrosine phosphorylation
GO:0070887	0.853	cellular response to chemical stimulus
GO:0023052	0.833	signaling
GO:0007154	0.833	cell communication
GO:1901700	0.830	response to oxygen-containing compound
GO:0010243	0.798	response to organonitrogen compound
GO:0048167	0.790	regulation of synaptic plasticity
GO:0043066	0.790	negative regulation of apoptotic process
GO:0043269	0.777	regulation of monoatomic ion transport
GO:0071704	0.766	organic substance metabolic process
GO:0010942	0.756	positive regulation of cell death
GO:0044238	0.755	primary metabolic process
GO:1903076	0.746	regulation of protein localization to plasma membrane
GO:1903829	0.741	positive regulation of protein localization
GO:0007165	0.721	signal transduction
GO:0010605	0.702	negative regulation of macromolecule metabolic process
GO:0006807	0.693	nitrogen compound metabolic process
GO:1904377	0.692	positive regulation of protein localization to cell periphery
GO:1905477	0.690	positive regulation of protein localization to membrane
GO:1904645	0.688	response to amyloid-beta
GO:0071310	0.677	cellular response to organic substance
GO:0048583	0.666	regulation of response to stimulus
GO:0043170	0.640	macromolecule metabolic process
GO:1903078	0.626	positive regulation of protein localization to plasma membrane
GO:1901564	0.612	organonitrogen compound metabolic process
GO:0010035	0.611	response to inorganic substance
GO:1901699	0.606	cellular response to nitrogen compound
GO:0106027	0.605	neuron projection organization
GO:0046688	0.597	response to copper ion
GO:0044092	0.586	negative regulation of molecular function
GO:0051248	0.559	negative regulation of protein metabolic process
GO:1901701	0.547	cellular response to oxygen-containing compound
GO:0019538	0.515	protein metabolic process
GO:1901214	0.506	regulation of neuron death
GO:0034762	0.487	regulation of transmembrane transport
GO:0035556	0.454	intracellular signal transduction
GO:0051338	0.436	regulation of transferase activity
GO:0007613	0.423	memory
GO:0071495	0.422	cellular response to endogenous stimulus
GO:0010629	0.414	negative regulation of gene expression
GO:0044237	0.410	cellular metabolic process
GO:0044093	0.406	positive regulation of molecular function
GO:0043085	0.402	positive regulation of catalytic activity
GO:0043549	0.388	regulation of kinase activity
GO:0071417	0.385	cellular response to organonitrogen compound
GO:0051179	0.349	localization
GO:0034765	0.343	regulation of monoatomic ion transmembrane transport
GO:1901216	0.340	positive regulation of neuron death
GO:0048856	0.325	anatomical structure development
GO:0019932	0.324	second-messenger-mediated signaling
GO:1901653	0.320	cellular response to peptide
GO:1904646	0.303	cellular response to amyloid-beta

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005634	0.998	nucleus
GO:0005829	0.997	cytosol
GO:0031090	0.996	organelle membrane
GO:0031965	0.990	nuclear membrane
GO:0071944	0.947	cell periphery
GO:0005576	0.906	extracellular region
GO:0031982	0.895	vesicle
GO:0005886	0.790	plasma membrane
GO:0009986	0.745	cell surface
GO:0030054	0.709	cell junction
GO:0045202	0.687	synapse
GO:0070013	0.506	intracellular organelle lumen
GO:0019898	0.369	extrinsic component of membrane
GO:0031981	0.354	nuclear lumen
GO:0016234	0.353	inclusion body
GO:0120025	0.336	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]