StarFunc result for job id P04179

User Input

>input (222 residues)
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NL29	0.949	0.949	7.520E-40	222	1.000	1.000	A0A384NL29.pdb.gz	A0A384NL29_HUMAN Superoxide dismutase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P07895	0.946	0.946	1.846E-36	222	0.878	0.878	P07895.pdb.gz	SODM_RAT Superoxide dismutase [Mn], mitochondrial OS=Rattus norvegicus OX=10116 GN=Sod2 PE=1 SV=2
3	AFDB:Q2TV65	0.925	0.917	4.281E-35	224	0.824	0.817	Q2TV65.pdb.gz
4	PDB:7kksA	0.894	0.997	1.817E-34	199	0.892	0.995	7kksA.pdb.gz	Direct detection of coupled proton and electron transfers in human manganese superoxide dismutase.
5	AFDB:P31161	0.926	0.930	1.239E-29	221	0.635	0.638	P31161.pdb.gz	SODM1_CAEEL Superoxide dismutase [Mn] 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sod-2 PE=1 SV=1
6	AFDB:P41977	0.928	0.944	3.571E-28	218	0.604	0.615	P41977.pdb.gz	SODM2_CAEEL Superoxide dismutase [Mn] 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sod-3 PE=1 SV=2
7	AFDB:Q00637	0.917	0.938	5.816E-28	217	0.572	0.585	Q00637.pdb.gz	SODM_DROME Superoxide dismutase [Mn], mitochondrial OS=Drosophila melanogaster OX=7227 GN=Sod2 PE=2 SV=3
8	AFDB:J9VWW9	0.853	0.842	1.465E-25	225	0.523	0.516	J9VWW9.pdb.gz	SODM_CRYNH Superoxide dismutase [Mn], mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=SOD2 PE=1 SV=1
9	AFDB:P11796	0.915	0.891	1.547E-25	228	0.545	0.531	P11796.pdb.gz	SODM_NICPL Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=SODA PE=1 SV=1
10	AFDB:O81235	0.881	0.847	2.808E-25	231	0.541	0.519	O81235.pdb.gz	SODM1_ARATH Superoxide dismutase [Mn] 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MSD1 PE=1 SV=2
11	AFDB:P09233	0.904	0.855	3.129E-25	235	0.527	0.498	P09233.pdb.gz	SODM1_MAIZE Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays OX=4577 GN=SODA.4 PE=2 SV=1
12	PDB:1kkcA	0.829	0.918	1.895E-21	200	0.455	0.505	1kkcA.pdb.gz	Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
13	PDB:1gn2A	0.856	0.958	2.112E-21	198	0.464	0.520	1gn2A.pdb.gz	Engineering of an Intersubunit Disulfide Bridge in the Iron-Superoxide Dismutase of Mycobacterium Tuberculosis.
14	PDB:3ak3B	0.847	0.881	8.190E-21	213	0.401	0.418	3ak3B.pdb.gz	Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
15	PDB:3rn4A	0.832	0.899	2.058E-20	205	0.414	0.449	3rn4A.pdb.gz	Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
16	PDB:1y67D	0.786	0.815	3.094E-19	214	0.423	0.439	1y67D.pdb.gz	Refinement of Macromolecular Structures by the Maximum-Likelihood Method
17	PDB:1d5nA	0.782	0.846	1.661E-18	205	0.387	0.420	1d5nA.pdb.gz	Cryo-trapping the six-coordinate, distorted-octahedral active site of manganese superoxide dismutase.
18	PDB:2bkbA	0.743	0.857	7.177E-18	192	0.365	0.422	2bkbA.pdb.gz	The Crucial Importance of Chemistry in the Structure-Function Link: Manipulating Hydrogen Bonding in Iron-Containing Superoxide Dismutase.
19	PDB:2bpiA	0.759	0.853	1.804E-17	197	0.356	0.401	2bpiA.pdb.gz	The Crystal Structure of Superoxide Dismutase from Plasmodium Falciparum.
20	PDB:3ceiA	0.758	0.789	1.273E-14	213	0.293	0.305	3ceiA.pdb.gz	The crystal structure of the superoxide dismutase from Helicobacter pylori reveals a structured C-terminal extension

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NL29	4.58e-168	463	222	1.000	1.000	A0A384NL29_HUMAN Superoxide dismutase OS=Homo sapiens OX=9606 PE=2 SV=1
2	P04179	4.58e-168	463	222	1.000	1.000	SODM_HUMAN Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2 PE=1 SV=3
3	P09671	1.55e-151	421	222	0.901	0.901	SODM_MOUSE Superoxide dismutase [Mn], mitochondrial OS=Mus musculus OX=10090 GN=Sod2 PE=1 SV=3
4	P07895	1.22e-148	414	222	0.878	0.878	SODM_RAT Superoxide dismutase [Mn], mitochondrial OS=Rattus norvegicus OX=10116 GN=Sod2 PE=1 SV=2
5	Q6P980	3.43e-136	382	224	0.824	0.817	Q6P980_DANRE Superoxide dismutase OS=Danio rerio OX=7955 GN=cb463 PE=1 SV=1
6	F5GYZ5	2.49e-115	328	190	0.716	0.837	F5GYZ5_HUMAN Superoxide dismutase (Fragment) OS=Homo sapiens OX=9606 GN=SOD2 PE=1 SV=1
7	F5H4R2	1.43e-109	314	183	0.685	0.831	F5H4R2_HUMAN Superoxide dismutase (Fragment) OS=Homo sapiens OX=9606 GN=SOD2 PE=1 SV=1
8	P31161	3.48e-105	304	221	0.635	0.638	SODM1_CAEEL Superoxide dismutase [Mn] 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sod-2 PE=1 SV=1
9	P41977	2.51e-100	291	218	0.604	0.615	SODM2_CAEEL Superoxide dismutase [Mn] 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=sod-3 PE=1 SV=2
10	Q00637	7.20e-94	275	217	0.568	0.581	SODM_DROME Superoxide dismutase [Mn], mitochondrial OS=Drosophila melanogaster OX=7227 GN=Sod2 PE=2 SV=3
11	J9VWW9	7.18e-84	250	225	0.536	0.529	SODM_CRYNH Superoxide dismutase [Mn], mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=SOD2 PE=1 SV=1
12	O81235	1.24e-79	239	231	0.550	0.528	SODM1_ARATH Superoxide dismutase [Mn] 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MSD1 PE=1 SV=2
13	P11796	1.51e-77	234	228	0.554	0.539	SODM_NICPL Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia OX=4092 GN=SODA PE=1 SV=1
14	P09233	1.25e-76	232	235	0.536	0.506	SODM1_MAIZE Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays OX=4577 GN=SODA.4 PE=2 SV=1
15	P41980	1.94e-75	229	233	0.509	0.485	SODM4_MAIZE Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays OX=4577 GN=SODA.3 PE=2 SV=1
16	P41978	5.46e-73	223	232	0.491	0.470	SODM2_MAIZE Superoxide dismutase [Mn] 3.2, mitochondrial OS=Zea mays OX=4577 GN=SODA.1 PE=2 SV=1
17	G5EAY6	8.04e-73	222	223	0.495	0.493	G5EAY6_EMENI Superoxide dismutase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05577 PE=3 SV=1
18	P41979	9.83e-73	222	233	0.491	0.468	SODM3_MAIZE Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays OX=4577 GN=SODA.2 PE=2 SV=1
19	Q92450	1.06e-67	209	210	0.459	0.486	SODM_ASPFU Superoxide dismutase [Mn], mitochondrial OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sodB PE=1 SV=3
20	P9WGE7	7.97e-67	206	207	0.468	0.502	SODF_MYCTU Superoxide dismutase [Fe] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sodB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02777 Sod_Fe_C	3.2e-35	131.7	Iron/manganese superoxide dismutases, C-terminal domain
2	PF00081 Sod_Fe_N	5.2e-30	115.1	Iron/manganese superoxide dismutases, alpha-hairpin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000446252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270142	0.999	Superoxide dismutase [Cu-Zn]
2	9606.ENSP00000241052	0.996	Catalase
3	9606.ENSP00000371554	0.994	Extracellular superoxide dismutase [Cu-Zn]
4	9606.ENSP00000385824	0.989	Forkhead box protein O3
5	9606.ENSP00000407375	0.988	Glutathione peroxidase 1
6	9606.ENSP00000372191	0.987	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
7	9606.ENSP00000373477	0.971	Glutathione peroxidase 3
8	9606.ENSP00000374265	0.971	Glutathione peroxidase 2
9	9606.ENSP00000312311	0.967	Mitochondrial ribosomal protein L46
10	9606.ENSP00000357320	0.967	28S ribosomal protein S29, mitochondrial
11	9606.ENSP00000451828	0.967	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000354677	0.964	Glutathione peroxidase 7
13	9606.ENSP00000392398	0.964	Epididymal secretory glutathione peroxidase
14	9606.ENSP00000260102	0.963	Mitochondrial ribosomal protein L15
15	9606.ENSP00000417602	0.961	Belongs to the universal ribosomal protein uL29 family.
16	9606.ENSP00000306548	0.957	Mitochondrial ribosomal protein L13
17	9606.ENSP00000354581	0.957	Glutathione peroxidase 6
18	9606.ENSP00000423822	0.957	Glutathione peroxidase 8
19	9606.ENSP00000268124	0.956	DNA polymerase subunit gamma-1
20	9606.ENSP00000368880	0.955	Forkhead box protein O1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004784	1.000	superoxide dismutase activity
GO:0005515	0.996	protein binding
GO:0046914	0.976	transition metal ion binding
GO:0030145	0.912	manganese ion binding
GO:0042802	0.840	identical protein binding
GO:0097159	0.403	organic cyclic compound binding
GO:1901363	0.396	heterocyclic compound binding
GO:0003676	0.335	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0050896	0.995	response to stimulus
GO:0009636	0.987	response to toxic substance
GO:0072593	0.984	reactive oxygen species metabolic process
GO:0071451	0.984	cellular response to superoxide
GO:0098754	0.957	detoxification
GO:0006801	0.957	superoxide metabolic process
GO:0098869	0.945	cellular oxidant detoxification
GO:0065007	0.685	biological regulation
GO:0050789	0.584	regulation of biological process
GO:0071704	0.583	organic substance metabolic process
GO:0050794	0.460	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.948	intracellular organelle lumen
GO:0016020	0.872	membrane
GO:0032991	0.573	protein-containing complex
GO:0005759	0.463	mitochondrial matrix
GO:0005829	0.394	cytosol
GO:0005576	0.387	extracellular region
GO:0070062	0.328	extracellular exosome
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20696	1.000	2 H(+) + 2 superoxide = H2O2 + O2
EC:1.15.1.1	1.000	superoxide dismutase.

[back to server]